BLASTX nr result
ID: Cheilocostus21_contig00028627
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00028627 (1497 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OMO64726.1| hypothetical protein COLO4_31912 [Corchorus olito... 56 4e-06 >gb|OMO64726.1| hypothetical protein COLO4_31912 [Corchorus olitorius] Length = 99 Score = 55.8 bits (133), Expect = 4e-06 Identities = 30/60 (50%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = -3 Query: 1369 CTSHGQSREVKAAMLLLQAMEYATVQNGETP*KRSSTF-QDFVFDVYFGIYKHPRFAPTS 1193 CTSHG+S+EVKAA LL +AMEY T +G P ++ + F DV FGIYK P S Sbjct: 40 CTSHGRSQEVKAATLLHKAMEYETAHDGGAPRRKDRQHRRAFFCDVIFGIYKQNTVCPAS 99