BLASTX nr result
ID: Cheilocostus21_contig00028490
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00028490 (417 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009420650.1| PREDICTED: microfibrillar-associated protein... 70 3e-11 gb|POE91172.1| microfibrillar-associated protein 1 [Quercus suber] 65 7e-11 gb|PAN05260.1| hypothetical protein PAHAL_G02911 [Panicum hallii] 68 2e-10 ref|XP_021317209.1| microfibrillar-associated protein 1-like [So... 68 2e-10 ref|XP_008679400.1| microfibrillar-associated protein 1 [Zea may... 68 2e-10 gb|EEF36672.1| microfibril-associated protein, putative [Ricinus... 62 2e-10 ref|XP_004952231.1| microfibrillar-associated protein 1 [Setaria... 67 3e-10 ref|XP_006647159.1| PREDICTED: microfibrillar-associated protein... 67 3e-10 ref|XP_015626326.1| PREDICTED: microfibrillar-associated protein... 67 3e-10 ref|XP_020184266.1| microfibrillar-associated protein 1-like [Ae... 67 3e-10 gb|EMS52751.1| Microfibrillar-associated protein 1 [Triticum ura... 67 3e-10 gb|PAN11213.1| hypothetical protein PAHAL_B03196 [Panicum hallii] 67 5e-10 ref|XP_008227035.1| PREDICTED: microfibrillar-associated protein... 66 6e-10 ref|XP_020417408.1| microfibrillar-associated protein 1 [Prunus ... 66 6e-10 ref|XP_020096370.1| microfibrillar-associated protein 1-like [An... 66 6e-10 gb|KQJ98860.1| hypothetical protein BRADI_3g39560v3 [Brachypodiu... 65 1e-09 ref|XP_008799939.1| PREDICTED: microfibrillar-associated protein... 65 1e-09 gb|KDO66055.1| hypothetical protein CISIN_1g013977mg [Citrus sin... 65 1e-09 ref|XP_003574719.1| PREDICTED: microfibrillar-associated protein... 65 1e-09 ref|XP_010260413.1| PREDICTED: microfibrillar-associated protein... 65 2e-09 >ref|XP_009420650.1| PREDICTED: microfibrillar-associated protein 1-like [Musa acuminata subsp. malaccensis] ref|XP_009420651.1| PREDICTED: microfibrillar-associated protein 1-like [Musa acuminata subsp. malaccensis] Length = 432 Score = 70.1 bits (170), Expect = 3e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 1 GPLRSKYNAKMAGMNAPIAKPKGSKKLKDWEIK 99 GPLRSKYNAKMAGMNAPI KPKGSKKLKDWEIK Sbjct: 400 GPLRSKYNAKMAGMNAPIEKPKGSKKLKDWEIK 432 >gb|POE91172.1| microfibrillar-associated protein 1 [Quercus suber] Length = 114 Score = 65.1 bits (157), Expect = 7e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 4 PLRSKYNAKMAGMNAPIAKPKGSKKLKDWE 93 PLR+KYNAKMAGMNAPIAKPKGSKKLKDWE Sbjct: 83 PLRTKYNAKMAGMNAPIAKPKGSKKLKDWE 112 >gb|PAN05260.1| hypothetical protein PAHAL_G02911 [Panicum hallii] Length = 428 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 GPLRSKYNAKMAGMNAPIAKPKGSKKLKDWEIK 99 GPLR+KYNAKMAGMNAPIAKPKGSKKLKDW+ K Sbjct: 396 GPLRAKYNAKMAGMNAPIAKPKGSKKLKDWDAK 428 >ref|XP_021317209.1| microfibrillar-associated protein 1-like [Sorghum bicolor] gb|KXG27719.1| hypothetical protein SORBI_3005G033300 [Sorghum bicolor] gb|KXG27720.1| hypothetical protein SORBI_3005G033300 [Sorghum bicolor] Length = 429 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 GPLRSKYNAKMAGMNAPIAKPKGSKKLKDWEIK 99 GPLR+KYNAKMAGMNAPIAKPKGSKKLKDW+ K Sbjct: 397 GPLRAKYNAKMAGMNAPIAKPKGSKKLKDWDTK 429 >ref|XP_008679400.1| microfibrillar-associated protein 1 [Zea mays] gb|AQK57340.1| microfibrillar-associated protein-related [Zea mays] Length = 430 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 GPLRSKYNAKMAGMNAPIAKPKGSKKLKDWEIK 99 GPLR+KYNAKMAGMNAPIAKPKGSKKLKDW+ K Sbjct: 398 GPLRAKYNAKMAGMNAPIAKPKGSKKLKDWDAK 430 >gb|EEF36672.1| microfibril-associated protein, putative [Ricinus communis] Length = 64 Score = 62.4 bits (150), Expect = 2e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 7 LRSKYNAKMAGMNAPIAKPKGSKKLKDWE 93 LR+KYNAKMAGMNAPIAKPKGSKKLKDWE Sbjct: 35 LRAKYNAKMAGMNAPIAKPKGSKKLKDWE 63 >ref|XP_004952231.1| microfibrillar-associated protein 1 [Setaria italica] ref|XP_004952232.1| microfibrillar-associated protein 1 [Setaria italica] gb|KQL29180.1| hypothetical protein SETIT_017265mg [Setaria italica] gb|KQL29181.1| hypothetical protein SETIT_017265mg [Setaria italica] gb|KQL29182.1| hypothetical protein SETIT_017265mg [Setaria italica] Length = 430 Score = 67.0 bits (162), Expect = 3e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 GPLRSKYNAKMAGMNAPIAKPKGSKKLKDWEIK 99 GPLR+KYNAKMAGMNAPIAKPKGSKKLKDW+ K Sbjct: 398 GPLRAKYNAKMAGMNAPIAKPKGSKKLKDWDEK 430 >ref|XP_006647159.1| PREDICTED: microfibrillar-associated protein 1-like [Oryza brachyantha] Length = 434 Score = 67.0 bits (162), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 1 GPLRSKYNAKMAGMNAPIAKPKGSKKLKDWEIK 99 GPLR+KYNAKMAGMNAPIAKPKGSKK+KDW+ K Sbjct: 399 GPLRAKYNAKMAGMNAPIAKPKGSKKMKDWDTK 431 >ref|XP_015626326.1| PREDICTED: microfibrillar-associated protein 1 [Oryza sativa Japonica Group] dbj|BAD28194.1| putative MFAP1 protein [Oryza sativa Japonica Group] dbj|BAF08467.1| Os02g0280100 [Oryza sativa Japonica Group] gb|EAZ22583.1| hypothetical protein OsJ_06251 [Oryza sativa Japonica Group] dbj|BAS78114.1| Os02g0280100 [Oryza sativa Japonica Group] Length = 435 Score = 67.0 bits (162), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 1 GPLRSKYNAKMAGMNAPIAKPKGSKKLKDWEIK 99 GPLR+KYNAKMAGMNAPIAKPKGSKK+KDW+ K Sbjct: 400 GPLRAKYNAKMAGMNAPIAKPKGSKKMKDWDTK 432 >ref|XP_020184266.1| microfibrillar-associated protein 1-like [Aegilops tauschii subsp. tauschii] Length = 441 Score = 67.0 bits (162), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 1 GPLRSKYNAKMAGMNAPIAKPKGSKKLKDWEIK 99 GPLR+KYNAKMAGMNAPIAKPKGSKK+KDW+ K Sbjct: 406 GPLRTKYNAKMAGMNAPIAKPKGSKKMKDWDTK 438 >gb|EMS52751.1| Microfibrillar-associated protein 1 [Triticum urartu] Length = 441 Score = 67.0 bits (162), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 1 GPLRSKYNAKMAGMNAPIAKPKGSKKLKDWEIK 99 GPLR+KYNAKMAGMNAPIAKPKGSKK+KDW+ K Sbjct: 406 GPLRTKYNAKMAGMNAPIAKPKGSKKMKDWDTK 438 >gb|PAN11213.1| hypothetical protein PAHAL_B03196 [Panicum hallii] Length = 428 Score = 66.6 bits (161), Expect = 5e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 1 GPLRSKYNAKMAGMNAPIAKPKGSKKLKDWEIK 99 GPLR+KYN+KMAGMNAPIAKPKGSKKLKDW+ K Sbjct: 396 GPLRAKYNSKMAGMNAPIAKPKGSKKLKDWDAK 428 >ref|XP_008227035.1| PREDICTED: microfibrillar-associated protein 1-like [Prunus mume] Length = 433 Score = 66.2 bits (160), Expect = 6e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 4 PLRSKYNAKMAGMNAPIAKPKGSKKLKDWE 93 PLRSKYNAKMAGMNAPIAKPKGSKKLKDWE Sbjct: 402 PLRSKYNAKMAGMNAPIAKPKGSKKLKDWE 431 >ref|XP_020417408.1| microfibrillar-associated protein 1 [Prunus persica] gb|ONI13508.1| hypothetical protein PRUPE_4G226700 [Prunus persica] Length = 433 Score = 66.2 bits (160), Expect = 6e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 4 PLRSKYNAKMAGMNAPIAKPKGSKKLKDWE 93 PLRSKYNAKMAGMNAPIAKPKGSKKLKDWE Sbjct: 402 PLRSKYNAKMAGMNAPIAKPKGSKKLKDWE 431 >ref|XP_020096370.1| microfibrillar-associated protein 1-like [Ananas comosus] gb|OAY68272.1| Microfibrillar-associated protein 1 [Ananas comosus] Length = 448 Score = 66.2 bits (160), Expect = 6e-10 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = +1 Query: 1 GPLRSKYNAKMAGMNAPIAKPKGSKKLKDWEIK 99 GPLR+KYNAKMAG+NAPIA+PKGSKK+KDW++K Sbjct: 416 GPLRAKYNAKMAGLNAPIARPKGSKKMKDWDVK 448 >gb|KQJ98860.1| hypothetical protein BRADI_3g39560v3 [Brachypodium distachyon] Length = 409 Score = 65.5 bits (158), Expect = 1e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 GPLRSKYNAKMAGMNAPIAKPKGSKKLKDWEIK 99 GPLR+KYNAKMAGMN PIAKPKGSKK+KDW+ K Sbjct: 374 GPLRAKYNAKMAGMNGPIAKPKGSKKMKDWDTK 406 >ref|XP_008799939.1| PREDICTED: microfibrillar-associated protein 1-like [Phoenix dactylifera] Length = 431 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 1 GPLRSKYNAKMAGMNAPIAKPKGSKKLKDWEIK 99 GPLR+KYN KMAGMNAPIAKPKGSKKLKDW+ K Sbjct: 399 GPLRAKYNTKMAGMNAPIAKPKGSKKLKDWDNK 431 >gb|KDO66055.1| hypothetical protein CISIN_1g013977mg [Citrus sinensis] gb|KDO66056.1| hypothetical protein CISIN_1g013977mg [Citrus sinensis] Length = 432 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 4 PLRSKYNAKMAGMNAPIAKPKGSKKLKDWEIK 99 PLR+KYNAKMAGMNAPIAKPKGSKKLKDWE + Sbjct: 401 PLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 432 >ref|XP_003574719.1| PREDICTED: microfibrillar-associated protein 1-like [Brachypodium distachyon] ref|XP_014756403.1| PREDICTED: microfibrillar-associated protein 1-like [Brachypodium distachyon] gb|KQJ98858.1| hypothetical protein BRADI_3g39560v3 [Brachypodium distachyon] gb|KQJ98859.1| hypothetical protein BRADI_3g39560v3 [Brachypodium distachyon] Length = 437 Score = 65.5 bits (158), Expect = 1e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 GPLRSKYNAKMAGMNAPIAKPKGSKKLKDWEIK 99 GPLR+KYNAKMAGMN PIAKPKGSKK+KDW+ K Sbjct: 402 GPLRAKYNAKMAGMNGPIAKPKGSKKMKDWDTK 434 >ref|XP_010260413.1| PREDICTED: microfibrillar-associated protein 1-like [Nelumbo nucifera] ref|XP_010260414.1| PREDICTED: microfibrillar-associated protein 1-like [Nelumbo nucifera] Length = 428 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 4 PLRSKYNAKMAGMNAPIAKPKGSKKLKDWE 93 PLR+KYNAKMAGMNAPIAKPKGSKKLKDWE Sbjct: 397 PLRAKYNAKMAGMNAPIAKPKGSKKLKDWE 426