BLASTX nr result
ID: Cheilocostus21_contig00028452
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00028452 (553 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009403485.1| PREDICTED: pentatricopeptide repeat-containi... 83 4e-15 ref|XP_008804854.1| PREDICTED: pentatricopeptide repeat-containi... 79 9e-14 gb|PKA65759.1| Pentatricopeptide repeat-containing protein [Apos... 74 5e-12 ref|XP_010905997.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 72 2e-11 ref|XP_020693715.1| pentatricopeptide repeat-containing protein ... 70 1e-10 ref|XP_019051734.1| PREDICTED: pentatricopeptide repeat-containi... 70 1e-10 ref|XP_020100255.1| pentatricopeptide repeat-containing protein ... 69 2e-10 ref|XP_020249479.1| pentatricopeptide repeat-containing protein ... 68 3e-10 ref|XP_017615876.1| PREDICTED: pentatricopeptide repeat-containi... 68 7e-10 gb|PPS06297.1| hypothetical protein GOBAR_AA14352 [Gossypium bar... 67 1e-09 ref|XP_020572143.1| pentatricopeptide repeat-containing protein ... 66 2e-09 gb|OMO68364.1| hypothetical protein COLO4_29731 [Corchorus olito... 66 3e-09 ref|XP_016738400.1| PREDICTED: pentatricopeptide repeat-containi... 65 4e-09 ref|XP_022748452.1| pentatricopeptide repeat-containing protein ... 65 6e-09 ref|XP_016680373.1| PREDICTED: pentatricopeptide repeat-containi... 65 6e-09 ref|XP_012441679.1| PREDICTED: pentatricopeptide repeat-containi... 65 6e-09 gb|EOY08249.1| Pentatricopeptide (PPR) repeat-containing protein... 64 2e-08 ref|XP_007027747.2| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_021289097.1| pentatricopeptide repeat-containing protein ... 63 3e-08 ref|XP_010096729.1| pentatricopeptide repeat-containing protein ... 62 5e-08 >ref|XP_009403485.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 [Musa acuminata subsp. malaccensis] ref|XP_009403486.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 [Musa acuminata subsp. malaccensis] ref|XP_018683615.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 [Musa acuminata subsp. malaccensis] ref|XP_018683616.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 [Musa acuminata subsp. malaccensis] ref|XP_018683617.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 [Musa acuminata subsp. malaccensis] Length = 500 Score = 82.8 bits (203), Expect = 4e-15 Identities = 40/58 (68%), Positives = 46/58 (79%) Frame = +1 Query: 1 EPNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLMERMQIGEKSHSS 174 +P+SV ILA GFS+EGR +EGE +V EMLDAG IPNIATYNKLMER+Q K HSS Sbjct: 443 KPDSVMLSILAHGFSREGRKREGECVVNEMLDAGFIPNIATYNKLMERLQTRRKPHSS 500 >ref|XP_008804854.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 [Phoenix dactylifera] Length = 494 Score = 79.0 bits (193), Expect = 9e-14 Identities = 36/57 (63%), Positives = 46/57 (80%) Frame = +1 Query: 1 EPNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLMERMQIGEKSHS 171 EP+ VT G+L +GFS+EGRT+EGE +V EMLD G IPNIA+YN+LME +Q G KS + Sbjct: 436 EPDGVTLGVLVKGFSREGRTREGEGVVDEMLDRGFIPNIASYNRLMEGLQNGNKSRT 492 >gb|PKA65759.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 491 Score = 73.9 bits (180), Expect = 5e-12 Identities = 34/52 (65%), Positives = 43/52 (82%) Frame = +1 Query: 1 EPNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLMERMQIG 156 +P+ VTF ILARGF++EGR +EGE +V EMLDAG I NIATYN+LM+ +Q G Sbjct: 440 DPDGVTFSILARGFAREGRKREGERVVDEMLDAGFIANIATYNRLMKELQTG 491 >ref|XP_010905997.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g36240 [Elaeis guineensis] Length = 494 Score = 72.4 bits (176), Expect = 2e-11 Identities = 33/56 (58%), Positives = 44/56 (78%) Frame = +1 Query: 4 PNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLMERMQIGEKSHS 171 P+ VT G+L +GFS+EGRT+EGE +V EMLD G I NIA+Y++LME +Q G KS + Sbjct: 437 PDGVTLGVLVKGFSREGRTREGEGVVDEMLDRGFIRNIASYDRLMEELQNGNKSQT 492 >ref|XP_020693715.1| pentatricopeptide repeat-containing protein At2g36240-like [Dendrobium catenatum] gb|PKU62287.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 491 Score = 70.1 bits (170), Expect = 1e-10 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +1 Query: 1 EPNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLMERMQIGE 159 +PN TF IL +GF+ EG+ KEGE +V EMLDAG IPNIA YN+LME +Q + Sbjct: 439 DPNGATFSILVQGFAGEGKKKEGERVVDEMLDAGFIPNIAVYNRLMEDLQFSK 491 >ref|XP_019051734.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 [Nelumbo nucifera] Length = 493 Score = 70.1 bits (170), Expect = 1e-10 Identities = 32/55 (58%), Positives = 42/55 (76%) Frame = +1 Query: 1 EPNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLMERMQIGEKS 165 EP+ VT+ L GFS+EG+TKEGE M+ EMLD G I +IA+YN+LM+ +Q G KS Sbjct: 429 EPDGVTYNALISGFSREGKTKEGEGMIDEMLDKGFITDIASYNRLMDGLQTGNKS 483 >ref|XP_020100255.1| pentatricopeptide repeat-containing protein At2g36240, partial [Ananas comosus] Length = 415 Score = 69.3 bits (168), Expect = 2e-10 Identities = 32/53 (60%), Positives = 41/53 (77%) Frame = +1 Query: 1 EPNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLMERMQIGE 159 EP+ VTF IL RGFS+EG+ KEGE ++ EMLD IPNIATYN+ +E +Q G+ Sbjct: 363 EPDGVTFSILVRGFSREGKGKEGEGVLDEMLDGDFIPNIATYNRYLEGLQRGK 415 >ref|XP_020249479.1| pentatricopeptide repeat-containing protein At2g36240-like [Asparagus officinalis] gb|ONK57147.1| uncharacterized protein A4U43_C10F17090 [Asparagus officinalis] Length = 260 Score = 67.8 bits (164), Expect = 3e-10 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = +1 Query: 7 NSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLMERMQ 150 + TFGIL RGFS+EGR +EGE +V EMLD G IPNIATYNKL + ++ Sbjct: 197 DGTTFGILVRGFSREGRVREGEKVVDEMLDGGFIPNIATYNKLRDGLK 244 >ref|XP_017615876.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 [Gossypium arboreum] Length = 492 Score = 67.8 bits (164), Expect = 7e-10 Identities = 33/64 (51%), Positives = 47/64 (73%) Frame = +1 Query: 1 EPNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLMERMQIGEKSHSSNL 180 EP+ VT+ IL G++++GR KEGE +V EMLD G IP+IATYN+LM+R+ S SS L Sbjct: 428 EPDEVTYNILVYGYTRDGRRKEGENLVDEMLDKGYIPDIATYNRLMDRL---SNSTSSTL 484 Query: 181 QSMN 192 + ++ Sbjct: 485 EKVS 488 >gb|PPS06297.1| hypothetical protein GOBAR_AA14352 [Gossypium barbadense] Length = 591 Score = 67.0 bits (162), Expect = 1e-09 Identities = 33/61 (54%), Positives = 45/61 (73%) Frame = +1 Query: 1 EPNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLMERMQIGEKSHSSNL 180 EP+ VT+ IL G++++GR KEGE +V EMLD G IP+IATYN+LM+R+ S SS L Sbjct: 428 EPDEVTYNILVYGYTRDGRRKEGENLVDEMLDKGYIPDIATYNRLMDRL---SNSTSSTL 484 Query: 181 Q 183 + Sbjct: 485 E 485 >ref|XP_020572143.1| pentatricopeptide repeat-containing protein At2g36240 [Phalaenopsis equestris] Length = 331 Score = 65.9 bits (159), Expect = 2e-09 Identities = 31/47 (65%), Positives = 35/47 (74%) Frame = +1 Query: 1 EPNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLME 141 +PN TF IL RGF +EG KEGE +V EMLDAG I NIA YN+LME Sbjct: 279 DPNGATFSILVRGFGREGMKKEGERVVDEMLDAGFISNIAIYNRLME 325 >gb|OMO68364.1| hypothetical protein COLO4_29731 [Corchorus olitorius] Length = 533 Score = 65.9 bits (159), Expect = 3e-09 Identities = 37/98 (37%), Positives = 56/98 (57%) Frame = +1 Query: 1 EPNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLMERMQIGEKSHSSNL 180 EP+ VT IL G+ +EGR KEGE +V EMLD G IP+IATYN+LM+ + S S + Sbjct: 428 EPDEVTCNILVHGYIREGRRKEGEVLVDEMLDKGFIPDIATYNRLMDAL---SNSRCSTM 484 Query: 181 QSMN**EDTESKYMENLFHITSKD*LRTEAQLLADMKR 294 + ++ Y+ ++ R +A ++ DM+R Sbjct: 485 KEVSPIHRDNMHYLLITTRKERQERSRKKATVIVDMER 522 >ref|XP_016738400.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like [Gossypium hirsutum] Length = 492 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/64 (50%), Positives = 46/64 (71%) Frame = +1 Query: 1 EPNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLMERMQIGEKSHSSNL 180 EP+ VT+ IL G++++GR KEGE +V EMLD G IP+IATY +LM+R+ S SS L Sbjct: 428 EPDEVTYNILVYGYTRDGRRKEGENLVDEMLDKGYIPDIATYTRLMDRL---SNSTSSTL 484 Query: 181 QSMN 192 + ++ Sbjct: 485 EKVS 488 >ref|XP_022748452.1| pentatricopeptide repeat-containing protein At2g36240 [Durio zibethinus] ref|XP_022748453.1| pentatricopeptide repeat-containing protein At2g36240 [Durio zibethinus] Length = 491 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/47 (59%), Positives = 38/47 (80%) Frame = +1 Query: 1 EPNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLME 141 EP+ VT+ IL G++++GR KEGE +V EMLD G IP+IATYN+LM+ Sbjct: 427 EPDEVTYSILVYGYTRDGRRKEGEILVDEMLDKGFIPDIATYNRLMD 473 >ref|XP_016680373.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like [Gossypium hirsutum] Length = 492 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/64 (50%), Positives = 46/64 (71%) Frame = +1 Query: 1 EPNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLMERMQIGEKSHSSNL 180 EP+ VT+ IL G++++GR KEGE +V EMLD G IP+IATYN+LM+ + S SS L Sbjct: 428 EPDEVTYNILVYGYTRDGRRKEGENLVDEMLDKGYIPDIATYNRLMDGL---SNSTSSKL 484 Query: 181 QSMN 192 + ++ Sbjct: 485 EKVS 488 >ref|XP_012441679.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 [Gossypium raimondii] gb|KJB62139.1| hypothetical protein B456_009G402600 [Gossypium raimondii] Length = 492 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/64 (50%), Positives = 46/64 (71%) Frame = +1 Query: 1 EPNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLMERMQIGEKSHSSNL 180 EP+ VT+ IL G++++GR KEGE +V EMLD G IP+IATYN+LM+ + S SS L Sbjct: 428 EPDEVTYNILVYGYTRDGRRKEGENLVDEMLDKGYIPDIATYNRLMDGL---SNSTSSKL 484 Query: 181 QSMN 192 + ++ Sbjct: 485 EKVS 488 >gb|EOY08249.1| Pentatricopeptide (PPR) repeat-containing protein, putative [Theobroma cacao] Length = 492 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +1 Query: 1 EPNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLME 141 EP+ VT+ IL G+++EGR KEGE +V EMLD G IP+IA YN+LM+ Sbjct: 426 EPDEVTYNILIYGYTREGRRKEGEILVDEMLDKGFIPDIARYNRLMD 472 >ref|XP_007027747.2| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 [Theobroma cacao] Length = 493 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +1 Query: 1 EPNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLME 141 EP+ VT+ IL G+++EGR KEGE +V EMLD G IP+IA YN+LM+ Sbjct: 427 EPDEVTYNILIYGYTREGRRKEGEILVDEMLDKGFIPDIARYNRLMD 473 >ref|XP_021289097.1| pentatricopeptide repeat-containing protein At2g36240 [Herrania umbratica] ref|XP_021289098.1| pentatricopeptide repeat-containing protein At2g36240 [Herrania umbratica] Length = 493 Score = 63.2 bits (152), Expect = 3e-08 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +1 Query: 1 EPNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLME 141 EP+ VT+ IL G+++EGR KEGE +V EMLD G IP+IA YN+LM+ Sbjct: 427 EPDEVTYDILIYGYTREGRRKEGEILVDEMLDKGFIPDIARYNRLMD 473 >ref|XP_010096729.1| pentatricopeptide repeat-containing protein At2g36240 [Morus notabilis] gb|EXB65581.1| hypothetical protein L484_025847 [Morus notabilis] Length = 547 Score = 62.4 bits (150), Expect = 5e-08 Identities = 27/48 (56%), Positives = 38/48 (79%) Frame = +1 Query: 4 PNSVTFGILARGFSKEGRTKEGEFMVTEMLDAGLIPNIATYNKLMERM 147 P+S+ + IL G++KEG KEGE +V EMLD G IP+IA+YN+LM+R+ Sbjct: 493 PDSMAYNILVSGYTKEGERKEGEKLVDEMLDKGFIPDIASYNRLMDRL 540