BLASTX nr result
ID: Cheilocostus21_contig00028272
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00028272 (613 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW45065.1| hypothetical protein EUGRSUZ_L013381, partial [Eu... 89 2e-19 ref|XP_012471741.1| PREDICTED: elongator complex protein 3-like ... 92 7e-19 gb|OMO99075.1| hypothetical protein CCACVL1_03939 [Corchorus cap... 92 5e-18 ref|XP_022878442.1| elongator complex protein 3-like [Olea europ... 92 6e-18 gb|PPD82251.1| hypothetical protein GOBAR_DD20808 [Gossypium bar... 92 6e-18 ref|XP_020587438.1| LOW QUALITY PROTEIN: elongator complex prote... 91 1e-17 ref|XP_013680894.1| elongator complex protein 3-like [Brassica n... 84 1e-17 gb|KJB40004.1| hypothetical protein B456_007G041800 [Gossypium r... 90 1e-17 ref|XP_009390795.1| PREDICTED: elongator complex protein 3 [Musa... 91 2e-17 ref|XP_022865906.1| elongator complex protein 3 [Olea europaea v... 91 2e-17 ref|XP_021286459.1| elongator complex protein 3 [Herrania umbrat... 89 2e-17 ref|XP_010485020.1| PREDICTED: elongator complex protein 3-like ... 84 2e-17 emb|CBI14868.3| unnamed protein product, partial [Vitis vinifera] 90 2e-17 ref|XP_008807205.1| PREDICTED: elongator complex protein 3 [Phoe... 90 3e-17 ref|XP_002262701.1| PREDICTED: elongator complex protein 3 [Viti... 90 3e-17 gb|PPR85246.1| hypothetical protein GOBAR_AA35453 [Gossypium bar... 90 3e-17 ref|XP_017634542.1| PREDICTED: elongator complex protein 3-like ... 90 3e-17 ref|XP_016710631.1| PREDICTED: elongator complex protein 3 [Goss... 90 3e-17 ref|XP_016695628.1| PREDICTED: elongator complex protein 3-like ... 90 3e-17 ref|XP_012489001.1| PREDICTED: elongator complex protein 3 [Goss... 90 3e-17 >gb|KCW45065.1| hypothetical protein EUGRSUZ_L013381, partial [Eucalyptus grandis] Length = 103 Score = 89.0 bits (219), Expect = 2e-19 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYL 134 EEAERIA REHRSTK+AVISGVGTRHYYRKLGYELEGPYMVKYL Sbjct: 59 EEAERIARREHRSTKIAVISGVGTRHYYRKLGYELEGPYMVKYL 102 >ref|XP_012471741.1| PREDICTED: elongator complex protein 3-like [Gossypium raimondii] gb|KJB20535.1| hypothetical protein B456_003G153300 [Gossypium raimondii] Length = 264 Score = 91.7 bits (226), Expect = 7e-19 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYLT 137 EEAERIAG+EHRSTK+AVISGVGTRHYYRKLGYEL+GPYMVKYLT Sbjct: 219 EEAERIAGKEHRSTKIAVISGVGTRHYYRKLGYELDGPYMVKYLT 263 >gb|OMO99075.1| hypothetical protein CCACVL1_03939 [Corchorus capsularis] Length = 564 Score = 92.0 bits (227), Expect = 5e-18 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYL 134 EEAERIAGREHRSTK+AVISGVGTRHYYRKLGYELEGPYMVKYL Sbjct: 520 EEAERIAGREHRSTKIAVISGVGTRHYYRKLGYELEGPYMVKYL 563 >ref|XP_022878442.1| elongator complex protein 3-like [Olea europaea var. sylvestris] Length = 563 Score = 91.7 bits (226), Expect = 6e-18 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYLT 137 EEAERIA REHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYLT Sbjct: 519 EEAERIARREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYLT 563 >gb|PPD82251.1| hypothetical protein GOBAR_DD20808 [Gossypium barbadense] Length = 565 Score = 91.7 bits (226), Expect = 6e-18 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYLT 137 EEAERIAG+EHRSTK+AVISGVGTRHYYRKLGYEL+GPYMVKYLT Sbjct: 520 EEAERIAGKEHRSTKIAVISGVGTRHYYRKLGYELDGPYMVKYLT 564 >ref|XP_020587438.1| LOW QUALITY PROTEIN: elongator complex protein 3 [Phalaenopsis equestris] Length = 525 Score = 90.9 bits (224), Expect = 1e-17 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYL 134 EEAERIAGREHRS KLAVISGVGTRHYYRKLGYELEGPYMVKYL Sbjct: 480 EEAERIAGREHRSAKLAVISGVGTRHYYRKLGYELEGPYMVKYL 523 >ref|XP_013680894.1| elongator complex protein 3-like [Brassica napus] Length = 82 Score = 83.6 bits (205), Expect = 1e-17 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYL 134 EEAERIA REHRS K+ VISGVGTRHYYRKLGYELEGPYMVK+L Sbjct: 38 EEAERIARREHRSNKIGVISGVGTRHYYRKLGYELEGPYMVKHL 81 >gb|KJB40004.1| hypothetical protein B456_007G041800 [Gossypium raimondii] Length = 378 Score = 89.7 bits (221), Expect = 1e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYL 134 EEAERIA REHRSTK+AVISGVGTRHYYRKLGYELEGPYMVKYL Sbjct: 334 EEAERIASREHRSTKIAVISGVGTRHYYRKLGYELEGPYMVKYL 377 >ref|XP_009390795.1| PREDICTED: elongator complex protein 3 [Musa acuminata subsp. malaccensis] Length = 561 Score = 90.5 bits (223), Expect = 2e-17 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYLT 137 EEAERIA REHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKY+T Sbjct: 517 EEAERIARREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYVT 561 >ref|XP_022865906.1| elongator complex protein 3 [Olea europaea var. sylvestris] Length = 563 Score = 90.5 bits (223), Expect = 2e-17 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYLT 137 EEAERIA REHRSTK+AVISGVGTRHYYRKLGYELEGPYMVKYLT Sbjct: 519 EEAERIAHREHRSTKVAVISGVGTRHYYRKLGYELEGPYMVKYLT 563 >ref|XP_021286459.1| elongator complex protein 3 [Herrania umbratica] Length = 330 Score = 89.0 bits (219), Expect = 2e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYL 134 EEAERIA REHRSTK+AVISGVGTRHYYRKLGYELEGPYMVKYL Sbjct: 286 EEAERIARREHRSTKIAVISGVGTRHYYRKLGYELEGPYMVKYL 329 >ref|XP_010485020.1| PREDICTED: elongator complex protein 3-like [Camelina sativa] Length = 105 Score = 83.6 bits (205), Expect = 2e-17 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYL 134 EEAERIA REHRS K+ VISGVGTRHYYRKLGYELEGPYMVK+L Sbjct: 61 EEAERIARREHRSNKIGVISGVGTRHYYRKLGYELEGPYMVKHL 104 >emb|CBI14868.3| unnamed protein product, partial [Vitis vinifera] Length = 455 Score = 89.7 bits (221), Expect = 2e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYL 134 E AERIAGREHRSTK+AVISGVGTRHYYRKLGYELEGPYMVKYL Sbjct: 411 EAAERIAGREHRSTKIAVISGVGTRHYYRKLGYELEGPYMVKYL 454 >ref|XP_008807205.1| PREDICTED: elongator complex protein 3 [Phoenix dactylifera] Length = 561 Score = 89.7 bits (221), Expect = 3e-17 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYL 134 EEAERIA REHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYL Sbjct: 517 EEAERIARREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYL 560 >ref|XP_002262701.1| PREDICTED: elongator complex protein 3 [Vitis vinifera] Length = 563 Score = 89.7 bits (221), Expect = 3e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYL 134 E AERIAGREHRSTK+AVISGVGTRHYYRKLGYELEGPYMVKYL Sbjct: 519 EAAERIAGREHRSTKIAVISGVGTRHYYRKLGYELEGPYMVKYL 562 >gb|PPR85246.1| hypothetical protein GOBAR_AA35453 [Gossypium barbadense] Length = 564 Score = 89.7 bits (221), Expect = 3e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYL 134 EEAERIA REHRSTK+AVISGVGTRHYYRKLGYELEGPYMVKYL Sbjct: 520 EEAERIASREHRSTKIAVISGVGTRHYYRKLGYELEGPYMVKYL 563 >ref|XP_017634542.1| PREDICTED: elongator complex protein 3-like [Gossypium arboreum] Length = 564 Score = 89.7 bits (221), Expect = 3e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYL 134 EEAERIA REHRSTK+AVISGVGTRHYYRKLGYELEGPYMVKYL Sbjct: 520 EEAERIASREHRSTKIAVISGVGTRHYYRKLGYELEGPYMVKYL 563 >ref|XP_016710631.1| PREDICTED: elongator complex protein 3 [Gossypium hirsutum] Length = 564 Score = 89.7 bits (221), Expect = 3e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYL 134 EEAERIA REHRSTK+AVISGVGTRHYYRKLGYELEGPYMVKYL Sbjct: 520 EEAERIASREHRSTKIAVISGVGTRHYYRKLGYELEGPYMVKYL 563 >ref|XP_016695628.1| PREDICTED: elongator complex protein 3-like [Gossypium hirsutum] Length = 564 Score = 89.7 bits (221), Expect = 3e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYL 134 EEAERIA REHRSTK+AVISGVGTRHYYRKLGYELEGPYMVKYL Sbjct: 520 EEAERIASREHRSTKIAVISGVGTRHYYRKLGYELEGPYMVKYL 563 >ref|XP_012489001.1| PREDICTED: elongator complex protein 3 [Gossypium raimondii] gb|KJB40003.1| hypothetical protein B456_007G041800 [Gossypium raimondii] Length = 564 Score = 89.7 bits (221), Expect = 3e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +3 Query: 3 EEAERIAGREHRSTKLAVISGVGTRHYYRKLGYELEGPYMVKYL 134 EEAERIA REHRSTK+AVISGVGTRHYYRKLGYELEGPYMVKYL Sbjct: 520 EEAERIASREHRSTKIAVISGVGTRHYYRKLGYELEGPYMVKYL 563