BLASTX nr result
ID: Cheilocostus21_contig00028128
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00028128 (631 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018681445.1| PREDICTED: AT-hook motif nuclear-localized p... 62 9e-08 ref|XP_009411492.1| PREDICTED: AT-hook motif nuclear-localized p... 62 1e-07 >ref|XP_018681445.1| PREDICTED: AT-hook motif nuclear-localized protein 1 isoform X2 [Musa acuminata subsp. malaccensis] Length = 337 Score = 62.0 bits (149), Expect = 9e-08 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +3 Query: 282 MEGRDGVIPSLTVSAAVEGSGNYQPPPPLLPAGMTREEKPASEIGSM 422 MEGR+G +PS AAVEGSG+Y+PP L AG+ REEKPASEIG M Sbjct: 1 MEGREGAVPS---PAAVEGSGSYRPPSSPLTAGLVREEKPASEIGGM 44 >ref|XP_009411492.1| PREDICTED: AT-hook motif nuclear-localized protein 1 isoform X1 [Musa acuminata subsp. malaccensis] Length = 381 Score = 62.0 bits (149), Expect = 1e-07 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +3 Query: 282 MEGRDGVIPSLTVSAAVEGSGNYQPPPPLLPAGMTREEKPASEIGSM 422 MEGR+G +PS AAVEGSG+Y+PP L AG+ REEKPASEIG M Sbjct: 1 MEGREGAVPS---PAAVEGSGSYRPPSSPLTAGLVREEKPASEIGGM 44