BLASTX nr result
ID: Cheilocostus21_contig00028000
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00028000 (549 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009380541.1| PREDICTED: BTB/POZ domain-containing protein... 67 2e-09 ref|XP_009380539.1| PREDICTED: BTB/POZ domain-containing protein... 67 2e-09 gb|AEW08884.1| hypothetical protein CL2108Contig1_03, partial [P... 60 5e-09 gb|OAY68566.1| BTB/POZ domain-containing protein POB1 [Ananas co... 61 7e-09 ref|XP_008798670.1| PREDICTED: BTB/POZ domain-containing protein... 63 3e-08 ref|XP_010914379.1| PREDICTED: BTB/POZ domain-containing protein... 62 5e-08 gb|PKA56290.1| BTB/POZ domain-containing protein POB1 [Apostasia... 62 6e-08 ref|XP_020091373.1| BTB/POZ domain-containing protein POB1-like ... 61 2e-07 ref|XP_020091367.1| BTB/POZ domain-containing protein POB1-like ... 61 2e-07 gb|OAY63363.1| BTB/POZ domain-containing protein POB1 [Ananas co... 61 2e-07 gb|KZV31522.1| hypothetical protein F511_07373 [Dorcoceras hygro... 60 3e-07 ref|XP_010925791.1| PREDICTED: BTB/POZ domain-containing protein... 60 4e-07 ref|XP_010925790.1| PREDICTED: BTB/POZ domain-containing protein... 60 4e-07 ref|XP_020584691.1| BTB/POZ domain-containing protein POB1-like ... 59 6e-07 gb|PKI66260.1| hypothetical protein CRG98_013341 [Punica granatum] 55 8e-07 gb|PIN13280.1| hypothetical protein CDL12_14101 [Handroanthus im... 59 1e-06 ref|XP_011073542.1| BTB/POZ domain-containing protein POB1-like ... 59 1e-06 ref|XP_010544783.1| PREDICTED: BTB/POZ domain-containing protein... 59 1e-06 gb|PON81824.1| Voltage dependent potassium channel [Trema orient... 59 1e-06 gb|ABR16891.1| unknown [Picea sitchensis] 58 1e-06 >ref|XP_009380541.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 555 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/39 (82%), Positives = 33/39 (84%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIKPPQPTSLQ 433 LFGIPW SFIA+DS FFIN TLHLRAELTIK PQ SLQ Sbjct: 517 LFGIPWTSFIAEDSLFFINGTLHLRAELTIKQPQTPSLQ 555 >ref|XP_009380539.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 572 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/39 (82%), Positives = 33/39 (84%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIKPPQPTSLQ 433 LFGIPW SFIA+DS FFIN TLHLRAELTIK PQ SLQ Sbjct: 534 LFGIPWTSFIAEDSLFFINGTLHLRAELTIKQPQTPSLQ 572 >gb|AEW08884.1| hypothetical protein CL2108Contig1_03, partial [Pinus radiata] gb|AFG44801.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] gb|AFG44802.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] gb|AFG44803.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] gb|AFG44804.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] gb|AFG44805.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] gb|AFG44806.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] gb|AFG44807.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] gb|AFG44808.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] gb|AFG44809.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] gb|AFG44810.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] gb|AFG44811.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] gb|AFG44812.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] gb|AFG44813.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] gb|AFG44814.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] gb|AFG44815.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] gb|AFG44816.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] gb|AFG44817.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] gb|AFG44818.1| hypothetical protein CL2108Contig1_03, partial [Pinus taeda] Length = 44 Score = 59.7 bits (143), Expect = 5e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIKP 454 LF PW+SF+ADDSP+FI DTLHLRAELTIKP Sbjct: 12 LFQTPWSSFMADDSPYFIKDTLHLRAELTIKP 43 >gb|OAY68566.1| BTB/POZ domain-containing protein POB1 [Ananas comosus] Length = 105 Score = 60.8 bits (146), Expect = 7e-09 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIKPPQ 448 LFGIPW SF+A DSP+FIN LHLRAELTIK PQ Sbjct: 61 LFGIPWTSFMATDSPYFINGVLHLRAELTIKQPQ 94 >ref|XP_008798670.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Phoenix dactylifera] Length = 537 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIKPPQPTSL 436 LFGIPW SF+ADDS +FIND LHLRAELTIK PQ L Sbjct: 499 LFGIPWTSFMADDSLYFINDVLHLRAELTIKQPQQQQL 536 >ref|XP_010914379.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Elaeis guineensis] Length = 537 Score = 62.4 bits (150), Expect = 5e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIKPPQ 448 LFGIPW SF+ADDS +FIND LHLRAELTIK PQ Sbjct: 499 LFGIPWTSFMADDSLYFINDVLHLRAELTIKQPQ 532 >gb|PKA56290.1| BTB/POZ domain-containing protein POB1 [Apostasia shenzhenica] Length = 542 Score = 62.0 bits (149), Expect = 6e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIKPPQP 445 LF IPW SF+A+DSP+FIN LHLRAELTIK PQP Sbjct: 504 LFAIPWTSFMAEDSPYFINGILHLRAELTIKQPQP 538 >ref|XP_020091373.1| BTB/POZ domain-containing protein POB1-like isoform X2 [Ananas comosus] Length = 547 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIKPPQ 448 LFGIPW SF+A DSP+FIN LHLRAELTIK PQ Sbjct: 509 LFGIPWTSFMATDSPYFINGVLHLRAELTIKQPQ 542 >ref|XP_020091367.1| BTB/POZ domain-containing protein POB1-like isoform X1 [Ananas comosus] Length = 549 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIKPPQ 448 LFGIPW SF+A DSP+FIN LHLRAELTIK PQ Sbjct: 511 LFGIPWTSFMATDSPYFINGVLHLRAELTIKQPQ 544 >gb|OAY63363.1| BTB/POZ domain-containing protein POB1 [Ananas comosus] Length = 567 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIKPPQ 448 LFGIPW SF+A DSP+FIN LHLRAELTIK PQ Sbjct: 521 LFGIPWTSFMATDSPYFINGVLHLRAELTIKQPQ 554 >gb|KZV31522.1| hypothetical protein F511_07373 [Dorcoceras hygrometricum] Length = 552 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIKP 454 LFG+PW +F+ADDSPFFIN LHLRAEL IKP Sbjct: 514 LFGVPWTAFVADDSPFFINGILHLRAELVIKP 545 >ref|XP_010925791.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 [Elaeis guineensis] Length = 507 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIKPPQPT 442 LF IPW SF+ADDS FFIN LHLRAELTIK P P+ Sbjct: 472 LFAIPWTSFMADDSLFFINGVLHLRAELTIKQPSPS 507 >ref|XP_010925790.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 [Elaeis guineensis] Length = 557 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIKPPQPT 442 LF IPW SF+ADDS FFIN LHLRAELTIK P P+ Sbjct: 522 LFAIPWTSFMADDSLFFINGVLHLRAELTIKQPSPS 557 >ref|XP_020584691.1| BTB/POZ domain-containing protein POB1-like [Phalaenopsis equestris] Length = 561 Score = 59.3 bits (142), Expect = 6e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIKPPQP 445 LF IPW +F+A+DS +F+ND LHLRAELTIK PQP Sbjct: 523 LFAIPWTAFMAEDSQYFMNDVLHLRAELTIKHPQP 557 >gb|PKI66260.1| hypothetical protein CRG98_013341 [Punica granatum] Length = 92 Score = 55.1 bits (131), Expect = 8e-07 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIK 457 LFGIPW +F+ADDS +F+N TLHLRAELTI+ Sbjct: 61 LFGIPWTAFMADDSAYFLNGTLHLRAELTIR 91 >gb|PIN13280.1| hypothetical protein CDL12_14101 [Handroanthus impetiginosus] Length = 546 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIK 457 LFG+PW +FIADDSP+FIN LHLRAELTIK Sbjct: 515 LFGVPWTAFIADDSPYFINGILHLRAELTIK 545 >ref|XP_011073542.1| BTB/POZ domain-containing protein POB1-like [Sesamum indicum] Length = 546 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIK 457 LFG+PW +FIADDSP+FIN LHLRAELTIK Sbjct: 515 LFGVPWTAFIADDSPYFINGILHLRAELTIK 545 >ref|XP_010544783.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Tarenaya hassleriana] Length = 558 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIK 457 LFGIPW SFIA+DSP+FIN LHLRAELTIK Sbjct: 522 LFGIPWTSFIAEDSPYFINGILHLRAELTIK 552 >gb|PON81824.1| Voltage dependent potassium channel [Trema orientalis] Length = 568 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIK 457 LF +PW SFIADDSPFFIN LHLRAELTIK Sbjct: 532 LFALPWTSFIADDSPFFINGVLHLRAELTIK 562 >gb|ABR16891.1| unknown [Picea sitchensis] Length = 430 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 549 LFGIPWNSFIADDSPFFINDTLHLRAELTIKP 454 LF PW+SF+A+DSP+FI DTLHLRAELTIKP Sbjct: 398 LFQTPWSSFMAEDSPYFIRDTLHLRAELTIKP 429