BLASTX nr result
ID: Cheilocostus21_contig00027829
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00027829 (1344 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009411609.1| PREDICTED: long chain acyl-CoA synthetase 1 ... 81 2e-12 ref|XP_018685819.1| PREDICTED: long chain acyl-CoA synthetase 1 ... 81 2e-12 gb|ONK63175.1| uncharacterized protein A4U43_C07F12180 [Asparagu... 68 2e-08 ref|XP_020275268.1| LOW QUALITY PROTEIN: long chain acyl-CoA syn... 68 2e-08 ref|XP_010921405.1| PREDICTED: long chain acyl-CoA synthetase 1 ... 68 2e-08 ref|XP_010921404.1| PREDICTED: long chain acyl-CoA synthetase 1 ... 68 2e-08 ref|XP_010921403.1| PREDICTED: long chain acyl-CoA synthetase 1 ... 68 2e-08 ref|XP_008781171.1| PREDICTED: long chain acyl-CoA synthetase 1 ... 67 4e-08 ref|XP_020267692.1| long chain acyl-CoA synthetase 1-like [Aspar... 65 2e-07 ref|XP_020691555.1| long chain acyl-CoA synthetase 1-like [Dendr... 62 2e-06 gb|OAY70857.1| Long chain acyl-CoA synthetase 1, partial [Ananas... 62 2e-06 ref|XP_020102295.1| long chain acyl-CoA synthetase 1-like [Anana... 62 2e-06 ref|XP_021972731.1| long chain acyl-CoA synthetase 4-like [Helia... 60 7e-06 gb|EPS71028.1| hypothetical protein M569_03729, partial [Genlise... 60 8e-06 >ref|XP_009411609.1| PREDICTED: long chain acyl-CoA synthetase 1 isoform X2 [Musa acuminata subsp. malaccensis] ref|XP_009411611.1| PREDICTED: long chain acyl-CoA synthetase 1 isoform X2 [Musa acuminata subsp. malaccensis] ref|XP_009411612.1| PREDICTED: long chain acyl-CoA synthetase 1 isoform X2 [Musa acuminata subsp. malaccensis] ref|XP_009411613.1| PREDICTED: long chain acyl-CoA synthetase 1 isoform X2 [Musa acuminata subsp. malaccensis] Length = 661 Score = 80.9 bits (198), Expect = 2e-12 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +3 Query: 3 VDSLPFDVERGLVTPTMKKKRAQMLKFYQSDIDKLYENILAEGK 134 VD LPFD+ER LVTPTMKKKRAQMLKFYQS+IDKLY NILAEG+ Sbjct: 617 VDPLPFDIERDLVTPTMKKKRAQMLKFYQSEIDKLYHNILAEGR 660 >ref|XP_018685819.1| PREDICTED: long chain acyl-CoA synthetase 1 isoform X1 [Musa acuminata subsp. malaccensis] Length = 691 Score = 80.9 bits (198), Expect = 2e-12 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +3 Query: 3 VDSLPFDVERGLVTPTMKKKRAQMLKFYQSDIDKLYENILAEGK 134 VD LPFD+ER LVTPTMKKKRAQMLKFYQS+IDKLY NILAEG+ Sbjct: 647 VDPLPFDIERDLVTPTMKKKRAQMLKFYQSEIDKLYHNILAEGR 690 >gb|ONK63175.1| uncharacterized protein A4U43_C07F12180 [Asparagus officinalis] Length = 613 Score = 68.2 bits (165), Expect = 2e-08 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = +3 Query: 3 VDSLPFDVERGLVTPTMKKKRAQMLKFYQSDIDKLYENILAEGK 134 VD PFD ER LVTPTMKKKRAQ+LK+YQ+DI+KLY+N LAEG+ Sbjct: 570 VDPQPFDTERDLVTPTMKKKRAQLLKYYQADIEKLYKN-LAEGR 612 >ref|XP_020275268.1| LOW QUALITY PROTEIN: long chain acyl-CoA synthetase 1-like [Asparagus officinalis] Length = 666 Score = 68.2 bits (165), Expect = 2e-08 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = +3 Query: 3 VDSLPFDVERGLVTPTMKKKRAQMLKFYQSDIDKLYENILAEGK 134 VD PFD ER LVTPTMKKKRAQ+LK+YQ+DI+KLY+N LAEG+ Sbjct: 623 VDPQPFDTERDLVTPTMKKKRAQLLKYYQADIEKLYKN-LAEGR 665 >ref|XP_010921405.1| PREDICTED: long chain acyl-CoA synthetase 1 isoform X3 [Elaeis guineensis] Length = 601 Score = 67.8 bits (164), Expect = 2e-08 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = +3 Query: 3 VDSLPFDVERGLVTPTMKKKRAQMLKFYQSDIDKLYENILAEGK 134 VD+LPFD+ER LVTPTMKKKR Q+LK+YQSDI+KLY ++ EG+ Sbjct: 558 VDALPFDIERDLVTPTMKKKRGQLLKYYQSDIEKLYRTLM-EGR 600 >ref|XP_010921404.1| PREDICTED: long chain acyl-CoA synthetase 1 isoform X2 [Elaeis guineensis] Length = 664 Score = 67.8 bits (164), Expect = 2e-08 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = +3 Query: 3 VDSLPFDVERGLVTPTMKKKRAQMLKFYQSDIDKLYENILAEGK 134 VD+LPFD+ER LVTPTMKKKR Q+LK+YQSDI+KLY ++ EG+ Sbjct: 621 VDALPFDIERDLVTPTMKKKRGQLLKYYQSDIEKLYRTLM-EGR 663 >ref|XP_010921403.1| PREDICTED: long chain acyl-CoA synthetase 1 isoform X1 [Elaeis guineensis] Length = 666 Score = 67.8 bits (164), Expect = 2e-08 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = +3 Query: 3 VDSLPFDVERGLVTPTMKKKRAQMLKFYQSDIDKLYENILAEGK 134 VD+LPFD+ER LVTPTMKKKR Q+LK+YQSDI+KLY ++ EG+ Sbjct: 623 VDALPFDIERDLVTPTMKKKRGQLLKYYQSDIEKLYRTLM-EGR 665 >ref|XP_008781171.1| PREDICTED: long chain acyl-CoA synthetase 1 [Phoenix dactylifera] Length = 661 Score = 67.0 bits (162), Expect = 4e-08 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +3 Query: 3 VDSLPFDVERGLVTPTMKKKRAQMLKFYQSDIDKLYENILAEGK 134 VD LPFD+ER LVTPTMKKKR Q+LK+YQSDI+KLY L EG+ Sbjct: 618 VDPLPFDIERDLVTPTMKKKRGQLLKYYQSDIEKLYRT-LTEGR 660 >ref|XP_020267692.1| long chain acyl-CoA synthetase 1-like [Asparagus officinalis] gb|ONK67628.1| uncharacterized protein A4U43_C05F2050 [Asparagus officinalis] Length = 618 Score = 64.7 bits (156), Expect = 2e-07 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +3 Query: 3 VDSLPFDVERGLVTPTMKKKRAQMLKFYQSDIDKLYENILAEGK 134 VD+ PFD+ER LVTPTMKKKR QMLK YQ+DI+++Y+N+ E K Sbjct: 575 VDARPFDIERDLVTPTMKKKRPQMLKCYQADIERVYKNLAEERK 618 >ref|XP_020691555.1| long chain acyl-CoA synthetase 1-like [Dendrobium catenatum] Length = 639 Score = 61.6 bits (148), Expect = 2e-06 Identities = 26/44 (59%), Positives = 37/44 (84%) Frame = +3 Query: 3 VDSLPFDVERGLVTPTMKKKRAQMLKFYQSDIDKLYENILAEGK 134 VD PFD+ER L+T TMKKKR+QMLK+YQ +I+++Y+N++ E K Sbjct: 596 VDPRPFDIERDLITATMKKKRSQMLKYYQVEIEQVYKNLVEENK 639 >gb|OAY70857.1| Long chain acyl-CoA synthetase 1, partial [Ananas comosus] Length = 641 Score = 61.6 bits (148), Expect = 2e-06 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = +3 Query: 3 VDSLPFDVERGLVTPTMKKKRAQMLKFYQSDIDKLYENI 119 VD +PF+VER L+TPTMKKKR+QM K YQS+I+KLY+N+ Sbjct: 594 VDPVPFNVERDLMTPTMKKKRSQMFKHYQSEIEKLYKNL 632 >ref|XP_020102295.1| long chain acyl-CoA synthetase 1-like [Ananas comosus] ref|XP_020102296.1| long chain acyl-CoA synthetase 1-like [Ananas comosus] ref|XP_020102298.1| long chain acyl-CoA synthetase 1-like [Ananas comosus] ref|XP_020102299.1| long chain acyl-CoA synthetase 1-like [Ananas comosus] Length = 669 Score = 61.6 bits (148), Expect = 2e-06 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = +3 Query: 3 VDSLPFDVERGLVTPTMKKKRAQMLKFYQSDIDKLYENI 119 VD +PF+VER L+TPTMKKKR+QM K YQS+I+KLY+N+ Sbjct: 618 VDPVPFNVERDLMTPTMKKKRSQMFKHYQSEIEKLYKNL 656 >ref|XP_021972731.1| long chain acyl-CoA synthetase 4-like [Helianthus annuus] gb|OTG20245.1| putative AMP-dependent synthetase and ligase family protein [Helianthus annuus] Length = 659 Score = 60.1 bits (144), Expect = 7e-06 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = +3 Query: 3 VDSLPFDVERGLVTPTMKKKRAQMLKFYQSDIDKLYENI 119 +D +PFD+ER L+TPT+KKKR QMLK+YQS ID +Y+N+ Sbjct: 619 LDPVPFDIERDLLTPTLKKKRPQMLKYYQSKIDDMYKNM 657 >gb|EPS71028.1| hypothetical protein M569_03729, partial [Genlisea aurea] Length = 610 Score = 59.7 bits (143), Expect = 8e-06 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = +3 Query: 3 VDSLPFDVERGLVTPTMKKKRAQMLKFYQSDIDKLYEN 116 +D +PFD+ER L+TPT KKKRAQ+LK+YQ ID++Y+N Sbjct: 571 IDPIPFDMERDLITPTFKKKRAQLLKYYQDVIDRMYKN 608