BLASTX nr result
ID: Cheilocostus21_contig00027794
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00027794 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009392425.1| PREDICTED: plant cysteine oxidase 4 [Musa ac... 80 4e-15 ref|XP_010910646.2| PREDICTED: plant cysteine oxidase 4-like [El... 77 5e-14 ref|XP_009415235.1| PREDICTED: plant cysteine oxidase 4 [Musa ac... 74 4e-13 ref|XP_008793029.1| PREDICTED: plant cysteine oxidase 4-like iso... 74 9e-13 ref|XP_008793026.1| PREDICTED: plant cysteine oxidase 4-like iso... 74 1e-12 ref|XP_008793025.1| PREDICTED: plant cysteine oxidase 4-like iso... 74 1e-12 ref|XP_008793023.1| PREDICTED: plant cysteine oxidase 4-like iso... 74 1e-12 ref|XP_008793021.1| PREDICTED: plant cysteine oxidase 4-like iso... 74 1e-12 ref|XP_008793020.1| PREDICTED: plant cysteine oxidase 4-like iso... 74 2e-12 ref|XP_010920194.2| PREDICTED: plant cysteine oxidase 4-like [El... 71 8e-12 ref|XP_008793031.1| PREDICTED: plant cysteine oxidase 4-like iso... 69 6e-11 ref|XP_017698907.1| PREDICTED: plant cysteine oxidase 4-like iso... 69 1e-10 ref|XP_008793032.1| PREDICTED: plant cysteine oxidase 4-like iso... 67 2e-10 ref|XP_010924604.1| PREDICTED: plant cysteine oxidase 4 isoform ... 65 6e-10 ref|XP_010924601.1| PREDICTED: plant cysteine oxidase 4 isoform ... 65 8e-10 ref|XP_008789374.1| PREDICTED: plant cysteine oxidase 4-like [Ph... 65 8e-10 ref|XP_020695391.1| plant cysteine oxidase 4-like isoform X2 [De... 65 1e-09 ref|XP_020695353.1| plant cysteine oxidase 4-like isoform X1 [De... 65 2e-09 gb|PKA55706.1| cysteamine dioxygenase [Apostasia shenzhenica] 64 4e-09 ref|XP_020244966.1| plant cysteine oxidase 4-like [Asparagus off... 64 4e-09 >ref|XP_009392425.1| PREDICTED: plant cysteine oxidase 4 [Musa acuminata subsp. malaccensis] ref|XP_018679447.1| PREDICTED: plant cysteine oxidase 4 [Musa acuminata subsp. malaccensis] ref|XP_018679448.1| PREDICTED: plant cysteine oxidase 4 [Musa acuminata subsp. malaccensis] Length = 244 Score = 79.7 bits (195), Expect = 4e-15 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -1 Query: 121 MPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPSD 2 MPAIRRLY+VCKISFS+NGP+SAEALEHVRSVLDDIKPSD Sbjct: 1 MPAIRRLYDVCKISFSDNGPLSAEALEHVRSVLDDIKPSD 40 >ref|XP_010910646.2| PREDICTED: plant cysteine oxidase 4-like [Elaeis guineensis] Length = 295 Score = 77.4 bits (189), Expect = 5e-14 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -1 Query: 130 SCSMPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPSD 2 SCSMPAI+RLY+ CK+SFS NGPIS EALEHVRS+LD+I+PSD Sbjct: 52 SCSMPAIQRLYDTCKVSFSPNGPISPEALEHVRSILDEIRPSD 94 >ref|XP_009415235.1| PREDICTED: plant cysteine oxidase 4 [Musa acuminata subsp. malaccensis] Length = 242 Score = 74.3 bits (181), Expect = 4e-13 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -1 Query: 121 MPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPSD 2 MPAI+RLY+ CK+SFS+NGPISAEALE+VRSVLDDIKPSD Sbjct: 1 MPAIKRLYDACKMSFSDNGPISAEALEYVRSVLDDIKPSD 40 >ref|XP_008793029.1| PREDICTED: plant cysteine oxidase 4-like isoform X7 [Phoenix dactylifera] ref|XP_008793030.1| PREDICTED: plant cysteine oxidase 4-like isoform X7 [Phoenix dactylifera] Length = 258 Score = 73.6 bits (179), Expect = 9e-13 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -1 Query: 130 SCSMPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPSD 2 SCSMPAI+RLY+ CK+SF NGP+S EALE VRS+LD+IKPSD Sbjct: 13 SCSMPAIQRLYDACKVSFCPNGPVSTEALEQVRSILDEIKPSD 55 >ref|XP_008793026.1| PREDICTED: plant cysteine oxidase 4-like isoform X6 [Phoenix dactylifera] ref|XP_008793027.1| PREDICTED: plant cysteine oxidase 4-like isoform X6 [Phoenix dactylifera] ref|XP_008793028.1| PREDICTED: plant cysteine oxidase 4-like isoform X6 [Phoenix dactylifera] Length = 262 Score = 73.6 bits (179), Expect = 1e-12 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -1 Query: 130 SCSMPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPSD 2 SCSMPAI+RLY+ CK+SF NGP+S EALE VRS+LD+IKPSD Sbjct: 17 SCSMPAIQRLYDACKVSFCPNGPVSTEALEQVRSILDEIKPSD 59 >ref|XP_008793025.1| PREDICTED: plant cysteine oxidase 4-like isoform X5 [Phoenix dactylifera] Length = 276 Score = 73.6 bits (179), Expect = 1e-12 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -1 Query: 130 SCSMPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPSD 2 SCSMPAI+RLY+ CK+SF NGP+S EALE VRS+LD+IKPSD Sbjct: 31 SCSMPAIQRLYDACKVSFCPNGPVSTEALEQVRSILDEIKPSD 73 >ref|XP_008793023.1| PREDICTED: plant cysteine oxidase 4-like isoform X4 [Phoenix dactylifera] ref|XP_008793024.1| PREDICTED: plant cysteine oxidase 4-like isoform X4 [Phoenix dactylifera] Length = 284 Score = 73.6 bits (179), Expect = 1e-12 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -1 Query: 130 SCSMPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPSD 2 SCSMPAI+RLY+ CK+SF NGP+S EALE VRS+LD+IKPSD Sbjct: 39 SCSMPAIQRLYDACKVSFCPNGPVSTEALEQVRSILDEIKPSD 81 >ref|XP_008793021.1| PREDICTED: plant cysteine oxidase 4-like isoform X3 [Phoenix dactylifera] Length = 295 Score = 73.6 bits (179), Expect = 1e-12 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -1 Query: 130 SCSMPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPSD 2 SCSMPAI+RLY+ CK+SF NGP+S EALE VRS+LD+IKPSD Sbjct: 100 SCSMPAIQRLYDACKVSFCPNGPVSTEALEQVRSILDEIKPSD 142 >ref|XP_008793020.1| PREDICTED: plant cysteine oxidase 4-like isoform X1 [Phoenix dactylifera] Length = 345 Score = 73.6 bits (179), Expect = 2e-12 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -1 Query: 130 SCSMPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPSD 2 SCSMPAI+RLY+ CK+SF NGP+S EALE VRS+LD+IKPSD Sbjct: 100 SCSMPAIQRLYDACKVSFCPNGPVSTEALEQVRSILDEIKPSD 142 >ref|XP_010920194.2| PREDICTED: plant cysteine oxidase 4-like [Elaeis guineensis] Length = 243 Score = 70.9 bits (172), Expect = 8e-12 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -1 Query: 121 MPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPSD 2 MPAI+RLY+ CK+SFS NGPIS EALEHVRS+LD+I+PSD Sbjct: 1 MPAIQRLYDTCKVSFSPNGPISPEALEHVRSILDEIRPSD 40 >ref|XP_008793031.1| PREDICTED: plant cysteine oxidase 4-like isoform X8 [Phoenix dactylifera] Length = 249 Score = 68.6 bits (166), Expect = 6e-11 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 124 SMPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPSD 2 SMPAI+RLY+ CK+SF NGP+S EALE VRS+LD+IKPSD Sbjct: 6 SMPAIQRLYDACKVSFCPNGPVSTEALEQVRSILDEIKPSD 46 >ref|XP_017698907.1| PREDICTED: plant cysteine oxidase 4-like isoform X2 [Phoenix dactylifera] Length = 332 Score = 68.6 bits (166), Expect = 1e-10 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 124 SMPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPSD 2 SMPAI+RLY+ CK+SF NGP+S EALE VRS+LD+IKPSD Sbjct: 89 SMPAIQRLYDACKVSFCPNGPVSTEALEQVRSILDEIKPSD 129 >ref|XP_008793032.1| PREDICTED: plant cysteine oxidase 4-like isoform X9 [Phoenix dactylifera] ref|XP_008793033.1| PREDICTED: plant cysteine oxidase 4-like isoform X9 [Phoenix dactylifera] ref|XP_008793035.1| PREDICTED: plant cysteine oxidase 4-like isoform X9 [Phoenix dactylifera] Length = 243 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 121 MPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPSD 2 MPAI+RLY+ CK+SF NGP+S EALE VRS+LD+IKPSD Sbjct: 1 MPAIQRLYDACKVSFCPNGPVSTEALEQVRSILDEIKPSD 40 >ref|XP_010924604.1| PREDICTED: plant cysteine oxidase 4 isoform X2 [Elaeis guineensis] Length = 219 Score = 65.5 bits (158), Expect = 6e-10 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -1 Query: 121 MPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPSD 2 MPAI+RLY+ CK+SF NGP+S EALE VRS+LD+I+PSD Sbjct: 1 MPAIQRLYDACKVSFCPNGPVSPEALEQVRSILDEIRPSD 40 >ref|XP_010924601.1| PREDICTED: plant cysteine oxidase 4 isoform X1 [Elaeis guineensis] ref|XP_010924602.1| PREDICTED: plant cysteine oxidase 4 isoform X1 [Elaeis guineensis] ref|XP_010924603.1| PREDICTED: plant cysteine oxidase 4 isoform X1 [Elaeis guineensis] Length = 243 Score = 65.5 bits (158), Expect = 8e-10 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -1 Query: 121 MPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPSD 2 MPAI+RLY+ CK+SF NGP+S EALE VRS+LD+I+PSD Sbjct: 1 MPAIQRLYDACKVSFCPNGPVSPEALEQVRSILDEIRPSD 40 >ref|XP_008789374.1| PREDICTED: plant cysteine oxidase 4-like [Phoenix dactylifera] ref|XP_008789376.1| PREDICTED: plant cysteine oxidase 4-like [Phoenix dactylifera] Length = 243 Score = 65.5 bits (158), Expect = 8e-10 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 121 MPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPSD 2 MPAI+RLY+ CK+SFS NGPIS EALE VR +LD+I+PSD Sbjct: 1 MPAIQRLYDACKVSFSPNGPISPEALEQVRFILDEIRPSD 40 >ref|XP_020695391.1| plant cysteine oxidase 4-like isoform X2 [Dendrobium catenatum] Length = 246 Score = 64.7 bits (156), Expect = 1e-09 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -1 Query: 121 MPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPS 5 MPAI+RLY+ CK+SFS NGPISAEA+E+V S+LD+IKPS Sbjct: 1 MPAIQRLYKACKVSFSPNGPISAEAIENVCSILDEIKPS 39 >ref|XP_020695353.1| plant cysteine oxidase 4-like isoform X1 [Dendrobium catenatum] ref|XP_020695361.1| plant cysteine oxidase 4-like isoform X1 [Dendrobium catenatum] ref|XP_020695369.1| plant cysteine oxidase 4-like isoform X1 [Dendrobium catenatum] ref|XP_020695375.1| plant cysteine oxidase 4-like isoform X1 [Dendrobium catenatum] ref|XP_020695383.1| plant cysteine oxidase 4-like isoform X1 [Dendrobium catenatum] Length = 247 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -1 Query: 121 MPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPS 5 MPAI+RLY+ CK+SFS NGPISAEA+E+V S+LD+IKPS Sbjct: 1 MPAIQRLYKACKVSFSPNGPISAEAIENVCSILDEIKPS 39 >gb|PKA55706.1| cysteamine dioxygenase [Apostasia shenzhenica] Length = 247 Score = 63.5 bits (153), Expect = 4e-09 Identities = 27/40 (67%), Positives = 37/40 (92%) Frame = -1 Query: 121 MPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPSD 2 MPA++RLY+ CKISFS +GPIS EA+++VRS+LD+IKPS+ Sbjct: 1 MPAVQRLYKACKISFSASGPISGEAIDNVRSILDEIKPSN 40 >ref|XP_020244966.1| plant cysteine oxidase 4-like [Asparagus officinalis] gb|ONK80134.1| uncharacterized protein A4U43_C01F14250 [Asparagus officinalis] Length = 250 Score = 63.5 bits (153), Expect = 4e-09 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -1 Query: 121 MPAIRRLYEVCKISFSENGPISAEALEHVRSVLDDIKPS 5 MP IR+LYE CK SFS NGPISAEALE VR+ LDDIKP+ Sbjct: 1 MPVIRKLYEACKASFSPNGPISAEALEKVRARLDDIKPA 39