BLASTX nr result
ID: Cheilocostus21_contig00027725
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00027725 (740 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008800548.1| PREDICTED: heavy metal-associated isoprenyla... 57 6e-06 gb|OAY79723.1| Copper transport protein ATX1 [Ananas comosus] 56 1e-05 >ref|XP_008800548.1| PREDICTED: heavy metal-associated isoprenylated plant protein 3 [Phoenix dactylifera] Length = 270 Score = 57.0 bits (136), Expect = 6e-06 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 738 VEDVTVDPAKDLVSVTGTMDAKTLPEILKGKLKRSVELLTP 616 V+ VT D KDLV+V GTMDAK LPE+LK KLKR+VE++ P Sbjct: 154 VQQVTADAQKDLVTVKGTMDAKALPEVLKEKLKRAVEVVPP 194 >gb|OAY79723.1| Copper transport protein ATX1 [Ananas comosus] Length = 253 Score = 56.2 bits (134), Expect = 1e-05 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 738 VEDVTVDPAKDLVSVTGTMDAKTLPEILKGKLKRSVELLTP 616 VE+V VD AKDLV+V GTMD K+LP +LK KLKR V+L+ P Sbjct: 134 VEEVKVDAAKDLVTVKGTMDPKSLPSLLKDKLKRGVDLVPP 174