BLASTX nr result
ID: Cheilocostus21_contig00027676
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00027676 (3035 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB13945.1| hypothetical protein B456_002G102900 [Gossypium r... 59 4e-06 gb|KJB81569.1| hypothetical protein B456_013G150400 [Gossypium r... 58 9e-06 ref|XP_023927415.1| calcineurin B-like protein 3 isoform X2 [Que... 58 1e-05 >gb|KJB13945.1| hypothetical protein B456_002G102900 [Gossypium raimondii] Length = 195 Score = 59.3 bits (142), Expect = 4e-06 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -1 Query: 1022 QVKQMVVATLAESGMNLSDDVIESIIDKVDTQNRSIKICMLSV 894 +VKQMVVATLAESGMNLSDDVIESIIDKV T++ +++ L + Sbjct: 143 EVKQMVVATLAESGMNLSDDVIESIIDKVITKSDLVEVISLVI 185 >gb|KJB81569.1| hypothetical protein B456_013G150400 [Gossypium raimondii] Length = 189 Score = 58.2 bits (139), Expect = 9e-06 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 1022 QVKQMVVATLAESGMNLSDDVIESIIDKVDTQNRSIKICML 900 +VKQMVVATLAESGMNLSDDVIESIIDKV Q I++ +L Sbjct: 143 EVKQMVVATLAESGMNLSDDVIESIIDKVIIQFDLIEVVLL 183 >ref|XP_023927415.1| calcineurin B-like protein 3 isoform X2 [Quercus suber] Length = 175 Score = 57.8 bits (138), Expect = 1e-05 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -1 Query: 1022 QVKQMVVATLAESGMNLSDDVIESIIDKVDTQNRSIKICMLSVPPRI 882 +VKQMVVATLAESGMNLSDDVIESIIDK R ++ +LS+ R+ Sbjct: 114 EVKQMVVATLAESGMNLSDDVIESIIDKCSGYFRHLRKLILSMMGRL 160