BLASTX nr result
ID: Cheilocostus21_contig00027529
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00027529 (717 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009390261.1| PREDICTED: cyclin-dependent kinase inhibitor... 57 3e-06 >ref|XP_009390261.1| PREDICTED: cyclin-dependent kinase inhibitor 3 [Musa acuminata subsp. malaccensis] Length = 208 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +1 Query: 1 ERDLLHRFAVRYNFDITNDAPLDGRYEWIPLTP 99 ERDL RF RYNFD+ D PL GRYEWIPLTP Sbjct: 176 ERDLRRRFVERYNFDVVKDVPLAGRYEWIPLTP 208