BLASTX nr result
ID: Cheilocostus21_contig00027528
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00027528 (430 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009390261.1| PREDICTED: cyclin-dependent kinase inhibitor... 57 5e-07 ref|XP_010916641.1| PREDICTED: cyclin-dependent kinase inhibitor... 55 2e-06 ref|XP_010666635.1| PREDICTED: cyclin-dependent kinase inhibitor... 55 3e-06 ref|XP_010028484.1| PREDICTED: cyclin-dependent kinase inhibitor... 54 5e-06 >ref|XP_009390261.1| PREDICTED: cyclin-dependent kinase inhibitor 3 [Musa acuminata subsp. malaccensis] Length = 208 Score = 57.0 bits (136), Expect = 5e-07 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -1 Query: 430 ERDLLHRFAVRYNFDITNDAPLDGRYEWIPLTP 332 ERDL RF RYNFD+ D PL GRYEWIPLTP Sbjct: 176 ERDLRRRFVERYNFDVVKDVPLAGRYEWIPLTP 208 >ref|XP_010916641.1| PREDICTED: cyclin-dependent kinase inhibitor 1 [Elaeis guineensis] Length = 201 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -1 Query: 430 ERDLLHRFAVRYNFDITNDAPLDGRYEWIPLTP 332 ERD RFA +YN+D+ ND PL+GRYEW+PL P Sbjct: 169 ERDEWQRFAAKYNYDVVNDVPLEGRYEWLPLIP 201 >ref|XP_010666635.1| PREDICTED: cyclin-dependent kinase inhibitor 7 [Beta vulgaris subsp. vulgaris] gb|KMS95987.1| hypothetical protein BVRB_003460 [Beta vulgaris subsp. vulgaris] Length = 228 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -1 Query: 430 ERDLLHRFAVRYNFDITNDAPLDGRYEWIPLTP 332 E+DL RF+ +YNFDI ND PL+GRYEW+PL P Sbjct: 196 EKDLHKRFSDKYNFDIVNDVPLNGRYEWVPLQP 228 >ref|XP_010028484.1| PREDICTED: cyclin-dependent kinase inhibitor 1 [Eucalyptus grandis] Length = 201 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -1 Query: 430 ERDLLHRFAVRYNFDITNDAPLDGRYEWIPL 338 ER+ RFA RYN+D+ NDAPL+GRYEWIPL Sbjct: 161 EREQQRRFAERYNYDVVNDAPLEGRYEWIPL 191