BLASTX nr result
ID: Cheilocostus21_contig00027395
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00027395 (453 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097911.2| tryptophan synthase beta chain 1 [Sesamum in... 72 1e-11 ref|XP_020109361.1| tryptophan synthase beta chain 1 [Ananas com... 71 2e-11 gb|EPS68191.1| tryptophan synthase beta subunit, partial [Genlis... 70 5e-11 gb|PNX54529.1| tryptophan synthase beta chain 2 chloroplastic-li... 64 7e-11 ref|XP_022886633.1| tryptophan synthase beta chain 1-like [Olea ... 69 8e-11 gb|KZN01280.1| hypothetical protein DCAR_010034 [Daucus carota s... 66 8e-11 ref|XP_008366477.1| PREDICTED: tryptophan synthase beta chain 2,... 68 1e-10 gb|POO00411.1| Tryptophan synthase [Trema orientalis] 69 1e-10 gb|PON34502.1| Tryptophan synthase [Parasponia andersonii] 69 1e-10 ref|XP_010262442.1| PREDICTED: tryptophan synthase beta chain 1 ... 68 2e-10 ref|XP_011016750.1| PREDICTED: tryptophan synthase beta chain 1 ... 68 2e-10 ref|XP_011030833.1| PREDICTED: tryptophan synthase beta chain 1-... 68 2e-10 ref|XP_009342584.1| PREDICTED: tryptophan synthase beta chain 1-... 68 2e-10 ref|XP_009358128.1| PREDICTED: tryptophan synthase beta chain 1 ... 68 2e-10 ref|XP_002317583.2| hypothetical protein POPTR_0011s13930g [Popu... 68 2e-10 ref|XP_022858214.1| tryptophan synthase beta chain 2, chloroplas... 66 3e-10 emb|CDP05778.1| unnamed protein product [Coffea canephora] 68 3e-10 gb|PIN17362.1| Tryptophan synthase beta chain [Handroanthus impe... 68 3e-10 ref|XP_012827501.1| PREDICTED: tryptophan synthase beta chain 1 ... 67 4e-10 ref|XP_021758843.1| tryptophan synthase beta chain 1-like [Cheno... 67 4e-10 >ref|XP_011097911.2| tryptophan synthase beta chain 1 [Sesamum indicum] Length = 449 Score = 71.6 bits (174), Expect = 1e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCP+LPDGTKVVLNCSGRGDKDVQTAIKHLEL Sbjct: 415 LEKLCPTLPDGTKVVLNCSGRGDKDVQTAIKHLEL 449 >ref|XP_020109361.1| tryptophan synthase beta chain 1 [Ananas comosus] gb|OAY63532.1| Tryptophan synthase beta chain 2, chloroplastic [Ananas comosus] Length = 466 Score = 70.9 bits (172), Expect = 2e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LEVLCP+LP+GTKVVLNCSGRGDKDVQTAIKHL+L Sbjct: 432 LEVLCPTLPNGTKVVLNCSGRGDKDVQTAIKHLQL 466 >gb|EPS68191.1| tryptophan synthase beta subunit, partial [Genlisea aurea] Length = 399 Score = 69.7 bits (169), Expect = 5e-11 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCPSLPDGTKVVLNCSGRGDKDV TAIKHL L Sbjct: 365 LETLCPSLPDGTKVVLNCSGRGDKDVHTAIKHLRL 399 >gb|PNX54529.1| tryptophan synthase beta chain 2 chloroplastic-like, partial [Trifolium pratense] Length = 58 Score = 63.9 bits (154), Expect = 7e-11 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCP+LP+GTKVV+NCSGRGDKDVQTAIK+L++ Sbjct: 24 LEKLCPTLPNGTKVVVNCSGRGDKDVQTAIKYLKI 58 >ref|XP_022886633.1| tryptophan synthase beta chain 1-like [Olea europaea var. sylvestris] ref|XP_022886634.1| tryptophan synthase beta chain 1-like [Olea europaea var. sylvestris] Length = 465 Score = 69.3 bits (168), Expect = 8e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCP LPDGTKVVLNCSGRGDKDVQTAIKHL+L Sbjct: 431 LEKLCPMLPDGTKVVLNCSGRGDKDVQTAIKHLKL 465 >gb|KZN01280.1| hypothetical protein DCAR_010034 [Daucus carota subsp. sativus] Length = 150 Score = 66.2 bits (160), Expect = 8e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLE 352 LE LCP LP+GTKVVLNCSGRGDKDVQTAIKHL+ Sbjct: 116 LEKLCPDLPNGTKVVLNCSGRGDKDVQTAIKHLK 149 >ref|XP_008366477.1| PREDICTED: tryptophan synthase beta chain 2, chloroplastic-like [Malus domestica] Length = 290 Score = 68.2 bits (165), Expect = 1e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCP+LPDG KVVLNCSGRGDKDVQTAIKHL+L Sbjct: 256 LEKLCPTLPDGAKVVLNCSGRGDKDVQTAIKHLKL 290 >gb|POO00411.1| Tryptophan synthase [Trema orientalis] Length = 476 Score = 68.6 bits (166), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCP+LP+GTKVVLNCSGRGDKDVQTAIKHL+L Sbjct: 442 LEKLCPTLPNGTKVVLNCSGRGDKDVQTAIKHLQL 476 >gb|PON34502.1| Tryptophan synthase [Parasponia andersonii] Length = 476 Score = 68.6 bits (166), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCP+LP+GTKVVLNCSGRGDKDVQTAIKHL+L Sbjct: 442 LEKLCPTLPNGTKVVLNCSGRGDKDVQTAIKHLQL 476 >ref|XP_010262442.1| PREDICTED: tryptophan synthase beta chain 1 [Nelumbo nucifera] Length = 463 Score = 68.2 bits (165), Expect = 2e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCP+LPDGTKVVLNCSGRGDKDVQTAIK+LE+ Sbjct: 429 LEKLCPTLPDGTKVVLNCSGRGDKDVQTAIKYLEV 463 >ref|XP_011016750.1| PREDICTED: tryptophan synthase beta chain 1 [Populus euphratica] Length = 472 Score = 68.2 bits (165), Expect = 2e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCP+LPDGTKVVLNCSGRGDKDVQTAIK+LE+ Sbjct: 438 LEKLCPTLPDGTKVVLNCSGRGDKDVQTAIKYLEV 472 >ref|XP_011030833.1| PREDICTED: tryptophan synthase beta chain 1-like [Populus euphratica] Length = 472 Score = 68.2 bits (165), Expect = 2e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCP+LPDGTKVVLNCSGRGDKDVQTAIK+LE+ Sbjct: 438 LEKLCPTLPDGTKVVLNCSGRGDKDVQTAIKYLEV 472 >ref|XP_009342584.1| PREDICTED: tryptophan synthase beta chain 1-like [Pyrus x bretschneideri] Length = 472 Score = 68.2 bits (165), Expect = 2e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCP+LPDG KVVLNCSGRGDKDVQTAIKHL+L Sbjct: 438 LEKLCPTLPDGAKVVLNCSGRGDKDVQTAIKHLKL 472 >ref|XP_009358128.1| PREDICTED: tryptophan synthase beta chain 1 [Pyrus x bretschneideri] Length = 472 Score = 68.2 bits (165), Expect = 2e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCP+LPDG KVVLNCSGRGDKDVQTAIKHL+L Sbjct: 438 LEKLCPTLPDGAKVVLNCSGRGDKDVQTAIKHLKL 472 >ref|XP_002317583.2| hypothetical protein POPTR_0011s13930g [Populus trichocarpa] gb|PNT13319.1| hypothetical protein POPTR_011G136000v3 [Populus trichocarpa] gb|PNT13320.1| hypothetical protein POPTR_011G136000v3 [Populus trichocarpa] Length = 472 Score = 68.2 bits (165), Expect = 2e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCP+LPDGTKVVLNCSGRGDKDVQTAIK+LE+ Sbjct: 438 LEKLCPTLPDGTKVVLNCSGRGDKDVQTAIKYLEV 472 >ref|XP_022858214.1| tryptophan synthase beta chain 2, chloroplastic [Olea europaea var. sylvestris] Length = 194 Score = 65.9 bits (159), Expect = 3e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCP+LPDGTKVVLNCSGRGDKDVQTAIK L+L Sbjct: 160 LEKLCPTLPDGTKVVLNCSGRGDKDVQTAIKLLKL 194 >emb|CDP05778.1| unnamed protein product [Coffea canephora] Length = 466 Score = 67.8 bits (164), Expect = 3e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCP+LPDG KVVLNCSGRGDKDVQTAIKHL L Sbjct: 432 LEKLCPTLPDGAKVVLNCSGRGDKDVQTAIKHLRL 466 >gb|PIN17362.1| Tryptophan synthase beta chain [Handroanthus impetiginosus] Length = 470 Score = 67.8 bits (164), Expect = 3e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCP+LPDGTKVV+NCSGRGDKDVQTAIKHL++ Sbjct: 436 LEKLCPTLPDGTKVVVNCSGRGDKDVQTAIKHLKV 470 >ref|XP_012827501.1| PREDICTED: tryptophan synthase beta chain 1 [Erythranthe guttata] gb|EYU19235.1| hypothetical protein MIMGU_mgv1a005837mg [Erythranthe guttata] Length = 468 Score = 67.4 bits (163), Expect = 4e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCP+LP GTKVVLNCSGRGDKDVQTAIKHL+L Sbjct: 434 LEKLCPTLPHGTKVVLNCSGRGDKDVQTAIKHLKL 468 >ref|XP_021758843.1| tryptophan synthase beta chain 1-like [Chenopodium quinoa] Length = 474 Score = 67.4 bits (163), Expect = 4e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 453 LEVLCPSLPDGTKVVLNCSGRGDKDVQTAIKHLEL 349 LE LCP+LP+GTKVVLNCSGRGDKDVQTAIKHL++ Sbjct: 440 LEQLCPTLPNGTKVVLNCSGRGDKDVQTAIKHLKI 474