BLASTX nr result
ID: Cheilocostus21_contig00027330
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00027330 (496 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009412009.1| PREDICTED: 5'-3' exoribonuclease 3 [Musa acu... 72 1e-11 >ref|XP_009412009.1| PREDICTED: 5'-3' exoribonuclease 3 [Musa acuminata subsp. malaccensis] Length = 1109 Score = 72.4 bits (176), Expect = 1e-11 Identities = 43/79 (54%), Positives = 45/79 (56%) Frame = +1 Query: 1 PYPSDNRSASQSVTHRPYEHHQAAYGARNYGGYQDSGTPQRERHYVSGWAPPPRPSQYPA 180 PYPS NR Q H PY H QA Y A NYGGY T Q E Y APP PSQ+ Sbjct: 1020 PYPSANRPVPQ---HGPYAHTQAPYNA-NYGGYHSYATQQWEEQYGDERAPP--PSQHTT 1073 Query: 181 GGSYSHQQQQTTNRYAALD 237 G S+ H QQTTNRY ALD Sbjct: 1074 GRSFGH-HQQTTNRYTALD 1091