BLASTX nr result
ID: Cheilocostus21_contig00027286
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00027286 (672 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009386871.1| PREDICTED: UDP-glucuronate 4-epimerase 6-lik... 73 3e-11 ref|XP_009412723.1| PREDICTED: UDP-glucuronate 4-epimerase 6-lik... 63 8e-08 ref|XP_002522810.2| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron... 59 2e-06 ref|XP_010274074.1| PREDICTED: UDP-glucuronate 4-epimerase 6-lik... 57 5e-06 ref|XP_023756588.1| UDP-glucuronate 4-epimerase 6-like [Lactuca ... 57 9e-06 ref|XP_022009197.1| UDP-glucuronate 4-epimerase 6-like [Helianth... 57 9e-06 ref|XP_010243459.1| PREDICTED: UDP-glucuronate 4-epimerase 6-lik... 57 9e-06 >ref|XP_009386871.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata subsp. malaccensis] Length = 465 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +3 Query: 546 MASLPDTSKSFKLERHSSYLLRRINSTKILAATSHLLFRISI 671 MAS PDTSKSFKLERH YLLRRINSTK++AA+SHLLFR SI Sbjct: 1 MASAPDTSKSFKLERHGGYLLRRINSTKVIAASSHLLFRASI 42 >ref|XP_009412723.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata subsp. malaccensis] Length = 466 Score = 62.8 bits (151), Expect = 8e-08 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +3 Query: 546 MASLPDTSKSFKLERHSSYLLRRINSTKILAATSHLLFRISI 671 MAS PDTSKS KLER++SYLLRR++S K++AA+SHLLFR +I Sbjct: 2 MASPPDTSKSSKLERYNSYLLRRVSSAKLIAASSHLLFRATI 43 >ref|XP_002522810.2| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6 [Ricinus communis] Length = 462 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = +3 Query: 546 MASLPDTSKSFKLERHSSYLLRRINSTKILAATSHLLFRISI 671 MAS PDTSK+ KLER++SYLLRR+++TKIL+A+S LLFR ++ Sbjct: 1 MASPPDTSKTIKLERYNSYLLRRMHTTKILSASSKLLFRCTL 42 >ref|XP_010274074.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera] Length = 456 Score = 57.4 bits (137), Expect = 5e-06 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = +3 Query: 546 MASLPDTSKSFKLERHSSYLLRRINSTKILAATSHLLFRISI 671 MAS PDTSK+ KLER++SYL RR+NSTK+LAA+S LLFR+++ Sbjct: 1 MASPPDTSKTTKLERYNSYL-RRVNSTKLLAASSKLLFRVTL 41 >ref|XP_023756588.1| UDP-glucuronate 4-epimerase 6-like [Lactuca sativa] gb|PLY90812.1| hypothetical protein LSAT_2X47461 [Lactuca sativa] Length = 447 Score = 56.6 bits (135), Expect = 9e-06 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = +3 Query: 546 MASLPDTSKSFKLERHSSYLLRRINSTKILAATSHLLFRISI 671 MAS PDTSK+ KLER++SY+ RR+NSTK+LAA+S LLFR+++ Sbjct: 1 MASPPDTSKTTKLERYNSYI-RRVNSTKLLAASSKLLFRVTL 41 >ref|XP_022009197.1| UDP-glucuronate 4-epimerase 6-like [Helianthus annuus] gb|OTF97539.1| putative UDP-D-glucuronate 4-epimerase 6 [Helianthus annuus] Length = 447 Score = 56.6 bits (135), Expect = 9e-06 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = +3 Query: 546 MASLPDTSKSFKLERHSSYLLRRINSTKILAATSHLLFRISI 671 MAS PDTSK+ KLER++SY+ RR+NSTK+LAA+S LLFR+++ Sbjct: 1 MASPPDTSKTTKLERYNSYI-RRVNSTKLLAASSKLLFRVTL 41 >ref|XP_010243459.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera] Length = 455 Score = 56.6 bits (135), Expect = 9e-06 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = +3 Query: 546 MASLPDTSKSFKLERHSSYLLRRINSTKILAATSHLLFRISI 671 MAS PDTSK+ KLER++SYL RR+NSTK LAA+S LLFR+++ Sbjct: 1 MASPPDTSKTTKLERYNSYL-RRVNSTKFLAASSKLLFRVTL 41