BLASTX nr result
ID: Cheilocostus21_contig00027202
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00027202 (504 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018684506.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 >ref|XP_018684506.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial [Musa acuminata subsp. malaccensis] Length = 503 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +2 Query: 2 EQVGVLAGKMRRSTSCTIQELSIAMDGRKRISYSQEE 112 EQVGVLA KMRRSTSCTIQEL IAM+GRKRI +++EE Sbjct: 467 EQVGVLADKMRRSTSCTIQELVIAMEGRKRIGHTREE 503