BLASTX nr result
ID: Cheilocostus21_contig00027111
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00027111 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009405740.1| PREDICTED: ARF guanine-nucleotide exchange f... 81 4e-15 ref|XP_009403225.1| PREDICTED: ARF guanine-nucleotide exchange f... 74 2e-12 ref|XP_020092293.1| ARF guanine-nucleotide exchange factor GNOM-... 58 7e-07 gb|OAY85170.1| ARF guanine-nucleotide exchange factor GNOM [Anan... 58 7e-07 gb|OVA18491.1| SEC7-like [Macleaya cordata] 57 9e-07 gb|KDP39263.1| hypothetical protein JCGZ_01020 [Jatropha curcas] 57 2e-06 ref|XP_012070992.1| ARF guanine-nucleotide exchange factor GNOM ... 57 2e-06 gb|PKI75498.1| hypothetical protein CRG98_004168 [Punica granatum] 56 2e-06 gb|OWM89514.1| hypothetical protein CDL15_Pgr024262 [Punica gran... 56 2e-06 gb|ONK64793.1| uncharacterized protein A4U43_C07F29980 [Asparagu... 55 3e-06 ref|XP_016433680.1| PREDICTED: ARF guanine-nucleotide exchange f... 56 3e-06 ref|XP_009628954.1| PREDICTED: ARF guanine-nucleotide exchange f... 56 3e-06 ref|XP_019230603.1| PREDICTED: ARF guanine-nucleotide exchange f... 56 3e-06 ref|XP_016449804.1| PREDICTED: ARF guanine-nucleotide exchange f... 56 3e-06 ref|XP_009789338.1| PREDICTED: ARF guanine-nucleotide exchange f... 56 3e-06 ref|XP_022138998.1| ARF guanine-nucleotide exchange factor GNOM-... 56 3e-06 ref|XP_020276000.1| LOW QUALITY PROTEIN: ARF guanine-nucleotide ... 55 4e-06 ref|XP_019455802.1| PREDICTED: ARF guanine-nucleotide exchange f... 55 4e-06 ref|XP_019455801.1| PREDICTED: ARF guanine-nucleotide exchange f... 55 4e-06 gb|OIW04070.1| hypothetical protein TanjilG_00630 [Lupinus angus... 55 4e-06 >ref|XP_009405740.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM [Musa acuminata subsp. malaccensis] Length = 1441 Score = 81.3 bits (199), Expect = 4e-15 Identities = 39/56 (69%), Positives = 44/56 (78%) Frame = -1 Query: 422 AEGSMNDGDNLWELTWGHMHNISPALQSEVFPVQEMEQLDSGVQTDQSRPVLAAEP 255 A+GS+ GDNLWELTW H++NI+P LQSEVFP QEMEQL G QTD S P L AEP Sbjct: 1383 AKGSIVGGDNLWELTWVHVNNIAPYLQSEVFPNQEMEQLHLGAQTDNSSPRLLAEP 1438 >ref|XP_009403225.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Musa acuminata subsp. malaccensis] Length = 1445 Score = 73.6 bits (179), Expect = 2e-12 Identities = 36/56 (64%), Positives = 44/56 (78%) Frame = -1 Query: 422 AEGSMNDGDNLWELTWGHMHNISPALQSEVFPVQEMEQLDSGVQTDQSRPVLAAEP 255 A+ S GD+LWELTW H++NI+P+LQSEVFP QEMEQL SGVQ + +R L AEP Sbjct: 1387 AKRSTIGGDSLWELTWLHVNNIAPSLQSEVFPGQEMEQLHSGVQPEGNRSGLLAEP 1442 >ref|XP_020092293.1| ARF guanine-nucleotide exchange factor GNOM-like [Ananas comosus] Length = 1369 Score = 57.8 bits (138), Expect = 7e-07 Identities = 30/51 (58%), Positives = 36/51 (70%), Gaps = 1/51 (1%) Frame = -1 Query: 422 AEGSMNDGDNLWELTWGHMHNISPALQSEVFPVQEMEQ-LDSGVQTDQSRP 273 A+ S GD+LWELTW H++NIS +LQSEVFP QE EQ L + QTD P Sbjct: 1298 AKRSTIGGDSLWELTWLHVNNISTSLQSEVFPGQESEQELHASKQTDSGSP 1348 >gb|OAY85170.1| ARF guanine-nucleotide exchange factor GNOM [Ananas comosus] Length = 1441 Score = 57.8 bits (138), Expect = 7e-07 Identities = 30/51 (58%), Positives = 36/51 (70%), Gaps = 1/51 (1%) Frame = -1 Query: 422 AEGSMNDGDNLWELTWGHMHNISPALQSEVFPVQEMEQ-LDSGVQTDQSRP 273 A+ S GD+LWELTW H++NIS +LQSEVFP QE EQ L + QTD P Sbjct: 1370 AKRSTIGGDSLWELTWLHVNNISTSLQSEVFPGQESEQELHASKQTDSGSP 1420 >gb|OVA18491.1| SEC7-like [Macleaya cordata] Length = 1453 Score = 57.4 bits (137), Expect = 9e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -1 Query: 401 GDNLWELTWGHMHNISPALQSEVFPVQEMEQLDSGVQTDQS 279 GD+LWELTW H++NI+P+LQSEVFP QE EQ G +TD S Sbjct: 1403 GDSLWELTWLHVNNIAPSLQSEVFPDQESEQRQGG-ETDAS 1442 >gb|KDP39263.1| hypothetical protein JCGZ_01020 [Jatropha curcas] Length = 1454 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/57 (45%), Positives = 39/57 (68%), Gaps = 7/57 (12%) Frame = -1 Query: 419 EGSMNDGDNLWELTWGHMHNISPALQSEVFPVQEMEQLD-------SGVQTDQSRPV 270 + S + GD+LWELTW H++ I+P+LQSEVFP QE+E+L G+ +D++ V Sbjct: 1388 QSSASGGDSLWELTWQHVNKIAPSLQSEVFPDQELEKLQPKNAESGGGIMSDETGSV 1444 >ref|XP_012070992.1| ARF guanine-nucleotide exchange factor GNOM [Jatropha curcas] Length = 1466 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/57 (45%), Positives = 39/57 (68%), Gaps = 7/57 (12%) Frame = -1 Query: 419 EGSMNDGDNLWELTWGHMHNISPALQSEVFPVQEMEQLD-------SGVQTDQSRPV 270 + S + GD+LWELTW H++ I+P+LQSEVFP QE+E+L G+ +D++ V Sbjct: 1400 QSSASGGDSLWELTWQHVNKIAPSLQSEVFPDQELEKLQPKNAESGGGIMSDETGSV 1456 >gb|PKI75498.1| hypothetical protein CRG98_004168 [Punica granatum] Length = 1276 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 401 GDNLWELTWGHMHNISPALQSEVFPVQEMEQL 306 GD+LWELTW H++NI+P+LQSEVFP QE EQL Sbjct: 1220 GDSLWELTWLHVNNIAPSLQSEVFPDQEQEQL 1251 >gb|OWM89514.1| hypothetical protein CDL15_Pgr024262 [Punica granatum] Length = 1460 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 401 GDNLWELTWGHMHNISPALQSEVFPVQEMEQL 306 GD+LWELTW H++NI+P+LQSEVFP QE EQL Sbjct: 1404 GDSLWELTWLHVNNIAPSLQSEVFPDQEQEQL 1435 >gb|ONK64793.1| uncharacterized protein A4U43_C07F29980 [Asparagus officinalis] Length = 275 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/47 (57%), Positives = 36/47 (76%), Gaps = 3/47 (6%) Frame = -1 Query: 422 AEGSMNDGDNLWELTWGHMHNISPALQSEVFPVQEMEQLD---SGVQ 291 A+ S GD+LW+LTW H++NI+P+LQ+EVFP QE EQ D SGV+ Sbjct: 222 AKRSTIGGDSLWDLTWLHVNNIAPSLQTEVFPDQESEQTDRSGSGVE 268 >ref|XP_016433680.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Nicotiana tabacum] Length = 1447 Score = 55.8 bits (133), Expect = 3e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 401 GDNLWELTWGHMHNISPALQSEVFPVQEMEQLD 303 GD+ W+LTW H+HNI P+LQSEVFP E+EQL+ Sbjct: 1395 GDSFWKLTWLHVHNICPSLQSEVFPTNELEQLE 1427 >ref|XP_009628954.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Nicotiana tomentosiformis] ref|XP_009628956.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Nicotiana tomentosiformis] ref|XP_018634162.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Nicotiana tomentosiformis] Length = 1447 Score = 55.8 bits (133), Expect = 3e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 401 GDNLWELTWGHMHNISPALQSEVFPVQEMEQLD 303 GD+ W+LTW H+HNI P+LQSEVFP E+EQL+ Sbjct: 1395 GDSFWKLTWLHVHNICPSLQSEVFPTNELEQLE 1427 >ref|XP_019230603.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Nicotiana attenuata] ref|XP_019230609.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Nicotiana attenuata] ref|XP_019230615.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Nicotiana attenuata] ref|XP_019230622.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Nicotiana attenuata] gb|OIT06474.1| arf guanine-nucleotide exchange factor gnom [Nicotiana attenuata] Length = 1448 Score = 55.8 bits (133), Expect = 3e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 401 GDNLWELTWGHMHNISPALQSEVFPVQEMEQLD 303 GD+ W+LTW H+HNI P+LQSEVFP E+EQL+ Sbjct: 1396 GDSFWKLTWLHVHNICPSLQSEVFPTNELEQLE 1428 >ref|XP_016449804.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Nicotiana tabacum] ref|XP_016449805.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Nicotiana tabacum] Length = 1448 Score = 55.8 bits (133), Expect = 3e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 401 GDNLWELTWGHMHNISPALQSEVFPVQEMEQLD 303 GD+ W+LTW H+HNI P+LQSEVFP E+EQL+ Sbjct: 1396 GDSFWKLTWLHVHNICPSLQSEVFPTNELEQLE 1428 >ref|XP_009789338.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Nicotiana sylvestris] ref|XP_009789339.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Nicotiana sylvestris] Length = 1448 Score = 55.8 bits (133), Expect = 3e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 401 GDNLWELTWGHMHNISPALQSEVFPVQEMEQLD 303 GD+ W+LTW H+HNI P+LQSEVFP E+EQL+ Sbjct: 1396 GDSFWKLTWLHVHNICPSLQSEVFPTNELEQLE 1428 >ref|XP_022138998.1| ARF guanine-nucleotide exchange factor GNOM-like [Momordica charantia] Length = 1470 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/53 (49%), Positives = 36/53 (67%), Gaps = 5/53 (9%) Frame = -1 Query: 401 GDNLWELTWGHMHNISPALQSEVFPVQEMEQL-----DSGVQTDQSRPVLAAE 258 GD LWELTW H++NISP+LQSEVFP Q+ + + GV + ++ PV + E Sbjct: 1407 GDGLWELTWLHVNNISPSLQSEVFPDQDSDHILGQGEKGGVTSSEANPVSSTE 1459 >ref|XP_020276000.1| LOW QUALITY PROTEIN: ARF guanine-nucleotide exchange factor GNOM-like [Asparagus officinalis] Length = 1435 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/47 (57%), Positives = 36/47 (76%), Gaps = 3/47 (6%) Frame = -1 Query: 422 AEGSMNDGDNLWELTWGHMHNISPALQSEVFPVQEMEQLD---SGVQ 291 A+ S GD+LW+LTW H++NI+P+LQ+EVFP QE EQ D SGV+ Sbjct: 1382 AKRSTIGGDSLWDLTWLHVNNIAPSLQTEVFPDQESEQTDRSGSGVE 1428 >ref|XP_019455802.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like isoform X2 [Lupinus angustifolius] Length = 1457 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/50 (54%), Positives = 36/50 (72%) Frame = -1 Query: 404 DGDNLWELTWGHMHNISPALQSEVFPVQEMEQLDSGVQTDQSRPVLAAEP 255 DG++LWELTW H++NI+P+LQSEVFP Q+ E L Q QS V ++ P Sbjct: 1392 DGNSLWELTWQHINNIAPSLQSEVFPEQDSEDL----QQKQSETVGSSGP 1437 >ref|XP_019455801.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like isoform X1 [Lupinus angustifolius] Length = 1496 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/50 (54%), Positives = 36/50 (72%) Frame = -1 Query: 404 DGDNLWELTWGHMHNISPALQSEVFPVQEMEQLDSGVQTDQSRPVLAAEP 255 DG++LWELTW H++NI+P+LQSEVFP Q+ E L Q QS V ++ P Sbjct: 1431 DGNSLWELTWQHINNIAPSLQSEVFPEQDSEDL----QQKQSETVGSSGP 1476 >gb|OIW04070.1| hypothetical protein TanjilG_00630 [Lupinus angustifolius] Length = 1507 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/50 (54%), Positives = 36/50 (72%) Frame = -1 Query: 404 DGDNLWELTWGHMHNISPALQSEVFPVQEMEQLDSGVQTDQSRPVLAAEP 255 DG++LWELTW H++NI+P+LQSEVFP Q+ E L Q QS V ++ P Sbjct: 1442 DGNSLWELTWQHINNIAPSLQSEVFPEQDSEDL----QQKQSETVGSSGP 1487