BLASTX nr result
ID: Cheilocostus21_contig00026619
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00026619 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018680589.1| PREDICTED: non-structural maintenance of chr... 72 4e-12 >ref|XP_018680589.1| PREDICTED: non-structural maintenance of chromosomes element 4 homolog A [Musa acuminata subsp. malaccensis] Length = 373 Score = 72.4 bits (176), Expect = 4e-12 Identities = 40/54 (74%), Positives = 43/54 (79%), Gaps = 1/54 (1%) Frame = -1 Query: 433 SKSKNGGVETAAHATPIRKLCRNRGLVIQEESVV-DSPEADACAQNHTKKRLFG 275 S S+ GGVE+AA ATPIRKL RNRGLVIQEES+V DSPE D QN KKRLFG Sbjct: 320 SGSEVGGVESAAPATPIRKLTRNRGLVIQEESIVEDSPETDTGVQNVKKKRLFG 373