BLASTX nr result
ID: Cheilocostus21_contig00026289
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00026289 (1153 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDY37626.1| BnaCnng08410D [Brassica napus] 57 4e-06 ref|XP_009387779.1| PREDICTED: uncharacterized protein LOC103974... 60 7e-06 >emb|CDY37626.1| BnaCnng08410D [Brassica napus] Length = 162 Score = 57.0 bits (136), Expect = 4e-06 Identities = 27/44 (61%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = -3 Query: 131 AVANVLFLFCV-SSGEKGFTQEWPNLLEIKGRVRLDAFERFLKE 3 +V++V+F+ + SGEK T+EWP LLEIKGRVRLDAFE+F++E Sbjct: 102 SVSSVIFVIGILKSGEKTTTKEWPRLLEIKGRVRLDAFEKFVRE 145 >ref|XP_009387779.1| PREDICTED: uncharacterized protein LOC103974637 [Musa acuminata subsp. malaccensis] Length = 1130 Score = 59.7 bits (143), Expect = 7e-06 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 131 AVANVLFLFCVSSGEKGFTQEWPNLLEIKGRVRLDAFERFLKE 3 A NV + SGEK TQEWP+LLEIKGRVRLDAFE+FLKE Sbjct: 699 ATVNVFY----KSGEKSSTQEWPSLLEIKGRVRLDAFEKFLKE 737