BLASTX nr result
ID: Cheilocostus21_contig00025472
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00025472 (568 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010926101.1| PREDICTED: microtubule-associated protein 70... 62 1e-07 ref|XP_010916223.1| PREDICTED: microtubule-associated protein 70... 59 9e-07 ref|XP_020083244.1| microtubule-associated protein 70-2-like [An... 58 2e-06 ref|XP_010932543.1| PREDICTED: microtubule-associated protein 70... 58 2e-06 ref|XP_008781372.1| PREDICTED: microtubule-associated protein 70... 58 2e-06 ref|XP_008775595.1| PREDICTED: microtubule-associated protein 70... 57 4e-06 ref|XP_018686568.1| PREDICTED: microtubule-associated protein 70... 56 7e-06 ref|XP_020089718.1| microtubule-associated protein 70-2-like [An... 56 9e-06 ref|XP_008812973.1| PREDICTED: microtubule-associated protein 70... 56 1e-05 >ref|XP_010926101.1| PREDICTED: microtubule-associated protein 70-1-like [Elaeis guineensis] Length = 626 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 566 AIRAGKEQDNRTNRLGSSKGPVNTSQMLTVRNQPRTGPGRNIQ 438 AIRA K+QDNR RLGSSKGPVN+SQ+L RN PR+G RN+Q Sbjct: 584 AIRAEKDQDNRAKRLGSSKGPVNSSQLLPGRNVPRSGLMRNVQ 626 >ref|XP_010916223.1| PREDICTED: microtubule-associated protein 70-1 isoform X1 [Elaeis guineensis] Length = 626 Score = 58.9 bits (141), Expect = 9e-07 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -3 Query: 566 AIRAGKEQDNRTNRLGSSKGPVNTSQMLTVRNQPRTGPGRNIQ 438 A+R+ KEQDNR RLGSSKGPVN+SQ+L RN PRTG R+ Q Sbjct: 584 AMRSEKEQDNRAKRLGSSKGPVNSSQLLPGRNVPRTGLMRHFQ 626 >ref|XP_020083244.1| microtubule-associated protein 70-2-like [Ananas comosus] gb|OAY66131.1| Microtubule-associated protein 70-2 [Ananas comosus] Length = 609 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -3 Query: 566 AIRAGKEQDNRTNRLGSSKGPVNTSQMLTVRNQPRTGPGRNIQ 438 A+R KEQDNR RL SSK PVNTSQ+L+ RN PR+G RN+Q Sbjct: 567 AMRVEKEQDNRAKRLSSSKAPVNTSQLLSGRNVPRSGLTRNVQ 609 >ref|XP_010932543.1| PREDICTED: microtubule-associated protein 70-2-like isoform X2 [Elaeis guineensis] Length = 620 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/43 (69%), Positives = 32/43 (74%) Frame = -3 Query: 566 AIRAGKEQDNRTNRLGSSKGPVNTSQMLTVRNQPRTGPGRNIQ 438 A+R KEQDNR RLGSSKGPVNTSQML RN R G RN+Q Sbjct: 578 AMRVEKEQDNRAKRLGSSKGPVNTSQMLPGRNVLRGGTMRNLQ 620 >ref|XP_008781372.1| PREDICTED: microtubule-associated protein 70-1-like [Phoenix dactylifera] Length = 625 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -3 Query: 566 AIRAGKEQDNRTNRLGSSKGPVNTSQMLTVRNQPRTGPGRNIQ 438 A+R K+QDNR RLGSS+GPVN+SQ+L RN PR+G RN+Q Sbjct: 583 AMRTEKDQDNRARRLGSSRGPVNSSQLLPGRNVPRSGLMRNVQ 625 >ref|XP_008775595.1| PREDICTED: microtubule-associated protein 70-1-like [Phoenix dactylifera] Length = 628 Score = 57.0 bits (136), Expect = 4e-06 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -3 Query: 566 AIRAGKEQDNRTNRLGSSKGPVNTSQMLTVRNQPRTGPGRNIQ 438 AIRA K QDNR RLGSSKGPVN+SQ+L RN PR+G R+ Q Sbjct: 586 AIRAEKGQDNRAKRLGSSKGPVNSSQLLPGRNVPRSGLMRHFQ 628 >ref|XP_018686568.1| PREDICTED: microtubule-associated protein 70-2-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 608 Score = 56.2 bits (134), Expect = 7e-06 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -3 Query: 566 AIRAGKEQDNRTNRLGSSKGPVNTSQMLTVRNQPRTGPGRNIQ 438 A+R KEQD+R R GSSKGPV+ SQ+L RN PRTG RN+Q Sbjct: 566 AMRVEKEQDSRAKRFGSSKGPVHVSQLLPGRNLPRTGMTRNLQ 608 >ref|XP_020089718.1| microtubule-associated protein 70-2-like [Ananas comosus] Length = 474 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = -3 Query: 566 AIRAGKEQDNRTNRLGSSKGPVNTSQMLTVRNQPRTGPGRNIQ 438 ++R GK+QD+R RL SSKGPVNT+Q+L+ +N P+TG RN Q Sbjct: 432 SMRVGKDQDSRAKRLSSSKGPVNTAQLLSGKNLPKTGLMRNFQ 474 >ref|XP_008812973.1| PREDICTED: microtubule-associated protein 70-2-like [Phoenix dactylifera] Length = 620 Score = 55.8 bits (133), Expect = 1e-05 Identities = 30/43 (69%), Positives = 31/43 (72%) Frame = -3 Query: 566 AIRAGKEQDNRTNRLGSSKGPVNTSQMLTVRNQPRTGPGRNIQ 438 AIRA KEQD R RLGSSKG VNTSQML RN R G RN+Q Sbjct: 578 AIRAEKEQDKRAKRLGSSKGSVNTSQMLPGRNVTRGGMMRNLQ 620