BLASTX nr result
ID: Cheilocostus21_contig00025364
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00025364 (608 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009384153.1| PREDICTED: auxin-responsive protein IAA10-li... 71 5e-11 ref|XP_009384146.1| PREDICTED: auxin-responsive protein IAA10-li... 71 5e-11 ref|XP_009386603.1| PREDICTED: auxin-responsive protein IAA10-li... 64 2e-08 ref|XP_009420443.1| PREDICTED: auxin-responsive protein IAA10-li... 63 3e-08 ref|XP_009420444.1| PREDICTED: auxin-responsive protein IAA10-li... 62 5e-08 >ref|XP_009384153.1| PREDICTED: auxin-responsive protein IAA10-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 347 Score = 71.2 bits (173), Expect = 5e-11 Identities = 37/56 (66%), Positives = 40/56 (71%) Frame = -1 Query: 608 PWRMFLETVKRLRIMRTSEANGLSRPVHFGKHEDVYPLRKXXXXXXXSPA*PLQPE 441 PW MFLETVKRLRIMRTS+ANGLS+ VHFGKH+D Y R PA LQPE Sbjct: 296 PWGMFLETVKRLRIMRTSDANGLSKSVHFGKHQDFYRQRN----DRKHPAYGLQPE 347 >ref|XP_009384146.1| PREDICTED: auxin-responsive protein IAA10-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 353 Score = 71.2 bits (173), Expect = 5e-11 Identities = 37/56 (66%), Positives = 40/56 (71%) Frame = -1 Query: 608 PWRMFLETVKRLRIMRTSEANGLSRPVHFGKHEDVYPLRKXXXXXXXSPA*PLQPE 441 PW MFLETVKRLRIMRTS+ANGLS+ VHFGKH+D Y R PA LQPE Sbjct: 302 PWGMFLETVKRLRIMRTSDANGLSKSVHFGKHQDFYRQRN----DRKHPAYGLQPE 353 >ref|XP_009386603.1| PREDICTED: auxin-responsive protein IAA10-like [Musa acuminata subsp. malaccensis] Length = 340 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 608 PWRMFLETVKRLRIMRTSEANGLSRPVHFGKHEDVYP 498 PW MFLE VKRLRIMRT +ANGL R +HFGKH++ YP Sbjct: 298 PWGMFLEAVKRLRIMRTLDANGLGRSIHFGKHQEHYP 334 >ref|XP_009420443.1| PREDICTED: auxin-responsive protein IAA10-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 340 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 608 PWRMFLETVKRLRIMRTSEANGLSRPVHFGKHE 510 PW MFLETVKRLRIMRTS+ANGLS+PVHFGK E Sbjct: 285 PWGMFLETVKRLRIMRTSDANGLSQPVHFGKLE 317 >ref|XP_009420444.1| PREDICTED: auxin-responsive protein IAA10-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 327 Score = 62.4 bits (150), Expect = 5e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 608 PWRMFLETVKRLRIMRTSEANGLSRPVHFGK 516 PW MFLETVKRLRIMRTS+ANGLS+PVHFGK Sbjct: 285 PWGMFLETVKRLRIMRTSDANGLSQPVHFGK 315