BLASTX nr result
ID: Cheilocostus21_contig00025219
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00025219 (550 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008807003.1| PREDICTED: uncharacterized protein LOC103719... 54 9e-06 >ref|XP_008807003.1| PREDICTED: uncharacterized protein LOC103719502 isoform X2 [Phoenix dactylifera] Length = 142 Score = 53.5 bits (127), Expect = 9e-06 Identities = 34/69 (49%), Positives = 41/69 (59%), Gaps = 9/69 (13%) Frame = +1 Query: 352 ISGQDKSS--TCTPITPKPNSVFLKPT---SIHGQEIDITREY----SQSIINSRVSGST 504 ISGQDK S T +PITPKP S KP S+H + D +R +Q +IN RVSG T Sbjct: 30 ISGQDKPSQNTISPITPKPFSPLPKPLPMHSVHAPDTDASRANPVTTAQELINYRVSGGT 89 Query: 505 HPISPIHRQ 531 H ISP + Q Sbjct: 90 HSISPAYPQ 98