BLASTX nr result
ID: Cheilocostus21_contig00025150
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00025150 (485 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009408461.1| PREDICTED: two-component response regulator ... 84 9e-16 ref|XP_009414786.1| PREDICTED: two-component response regulator ... 84 1e-15 >ref|XP_009408461.1| PREDICTED: two-component response regulator ORR21 [Musa acuminata subsp. malaccensis] ref|XP_009408473.1| PREDICTED: two-component response regulator ORR21 [Musa acuminata subsp. malaccensis] Length = 733 Score = 84.0 bits (206), Expect = 9e-16 Identities = 41/57 (71%), Positives = 43/57 (75%), Gaps = 3/57 (5%) Frame = +2 Query: 2 KGTCLPSRFTVDDIEPPTIELANSGTYTGDDAYFLNQDIY---GALQSGPCATTSFK 163 KGTCLPSRF VDDIE PT +L NS YTGDD Y NQDI+ G LQSG CATTSFK Sbjct: 677 KGTCLPSRFAVDDIESPTNDLTNSSAYTGDDGYLQNQDIFGISGTLQSGHCATTSFK 733 >ref|XP_009414786.1| PREDICTED: two-component response regulator ORR21-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 724 Score = 83.6 bits (205), Expect = 1e-15 Identities = 40/57 (70%), Positives = 45/57 (78%), Gaps = 3/57 (5%) Frame = +2 Query: 2 KGTCLPSRFTVDDIEPPTIELANSGTYTGDDAYFLNQDIY---GALQSGPCATTSFK 163 KGTCLPSRF VDDIE PT +L N+ TYTGDD + LNQDI+ GA QSG CA+TSFK Sbjct: 668 KGTCLPSRFAVDDIESPTNDLTNTSTYTGDDGFVLNQDIFGINGAFQSGHCASTSFK 724