BLASTX nr result
ID: Cheilocostus21_contig00025088
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00025088 (559 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009392347.1| PREDICTED: rop guanine nucleotide exchange f... 57 4e-06 ref|XP_009413379.1| PREDICTED: rop guanine nucleotide exchange f... 57 5e-06 ref|WP_073470626.1| hypothetical protein [Enterococcus faecium] 52 9e-06 >ref|XP_009392347.1| PREDICTED: rop guanine nucleotide exchange factor 1-like [Musa acuminata subsp. malaccensis] Length = 568 Score = 57.0 bits (136), Expect = 4e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -3 Query: 92 HLVFWEPKLEKREPDVSEVEMMKERFAKLL 3 HLVFWE KLEKRE D SEVEMMKERFAKLL Sbjct: 76 HLVFWESKLEKREADFSEVEMMKERFAKLL 105 >ref|XP_009413379.1| PREDICTED: rop guanine nucleotide exchange factor 1-like [Musa acuminata subsp. malaccensis] Length = 564 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 92 HLVFWEPKLEKREPDVSEVEMMKERFAKLL 3 HLV WEPKLEKR+ D SEVEMMKERFAKLL Sbjct: 68 HLVLWEPKLEKRDTDFSEVEMMKERFAKLL 97 >ref|WP_073470626.1| hypothetical protein [Enterococcus faecium] Length = 65 Score = 51.6 bits (122), Expect = 9e-06 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +3 Query: 486 CARSEERRVGKECRSRWSPYH 548 CARSEERRVGKECRSRWSPYH Sbjct: 45 CARSEERRVGKECRSRWSPYH 65