BLASTX nr result
ID: Cheilocostus21_contig00025058
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00025058 (1532 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009383444.1| PREDICTED: B-box zinc finger protein 22-like... 65 2e-08 >ref|XP_009383444.1| PREDICTED: B-box zinc finger protein 22-like [Musa acuminata subsp. malaccensis] ref|XP_009383445.1| PREDICTED: B-box zinc finger protein 22-like [Musa acuminata subsp. malaccensis] Length = 198 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/51 (62%), Positives = 37/51 (72%) Frame = +2 Query: 77 VPADSIANKKTQAATPSYAMEEGLKPQWLWNELLDTFEFDRHYGLSSEPGS 229 V ADSI N+K QAAT Y EEGL+P W WNE+L F+FD +GL SEPGS Sbjct: 144 VTADSIVNQKLQAATSGYVTEEGLRPPWPWNEILGGFQFDPCHGL-SEPGS 193