BLASTX nr result
ID: Cheilocostus21_contig00024818
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00024818 (1011 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O65049.1|TRXH_PICMA RecName: Full=Thioredoxin H-type; Short=T... 68 2e-10 gb|ABK20906.1| unknown [Picea sitchensis] >gi|116789762|gb|ABK25... 68 2e-10 gb|PKA46943.1| Thioredoxin H-type 2 [Apostasia shenzhenica] 67 3e-10 gb|PKU63496.1| Thioredoxin H1 [Dendrobium catenatum] 67 3e-10 ref|XP_020590107.1| thioredoxin H1 [Phalaenopsis equestris] 67 3e-10 gb|ABK24945.1| unknown [Picea sitchensis] >gi|116790214|gb|ABK25... 67 5e-10 gb|OAY74795.1| Thioredoxin H1 [Ananas comosus] 67 5e-10 ref|XP_020091655.1| thioredoxin H1-like [Ananas comosus] 67 5e-10 ref|XP_020677622.1| thioredoxin H1-like [Dendrobium catenatum] 67 6e-10 ref|XP_019245244.1| PREDICTED: thioredoxin H-type 1-like [Nicoti... 66 7e-10 ref|XP_020257567.1| thioredoxin H1-like [Asparagus officinalis] ... 66 9e-10 ref|XP_023749634.1| thioredoxin H1-like [Lactuca sativa] >gi|132... 66 1e-09 gb|ABK23262.1| unknown [Picea sitchensis] 65 1e-09 gb|ABK21322.1| unknown [Picea sitchensis] >gi|116788632|gb|ABK24... 65 1e-09 gb|OAE18646.1| hypothetical protein AXG93_3810s1150 [Marchantia ... 65 2e-09 gb|OIC62575.1| hypothetical protein A7L55_18720 [Acinetobacter b... 65 2e-09 ref|XP_017699037.1| PREDICTED: thioredoxin H1-like [Phoenix dact... 64 2e-09 ref|XP_009398388.1| PREDICTED: thioredoxin H1-like [Musa acumina... 65 2e-09 gb|PAN09877.1| hypothetical protein PAHAL_B00927 [Panicum hallii] 65 3e-09 ref|WP_082177828.1| thioredoxin [Acinetobacter baumannii] 65 3e-09 >sp|O65049.1|TRXH_PICMA RecName: Full=Thioredoxin H-type; Short=Trx-H gb|AAC32111.1| probable thioredoxin H [Picea mariana] Length = 125 Score = 68.2 bits (165), Expect = 2e-10 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = +1 Query: 853 AIFFTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMKGCH*LWD 993 A+ FT+TWCGPCR I P +VEL+KKFP++ FLK+DV+E++ WD Sbjct: 30 AVDFTATWCGPCRVIGPVFVELSKKFPEIFFLKVDVDELRDVAQEWD 76 >gb|ABK20906.1| unknown [Picea sitchensis] gb|ABK25373.1| unknown [Picea sitchensis] gb|ACN41092.1| unknown [Picea sitchensis] Length = 125 Score = 68.2 bits (165), Expect = 2e-10 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = +1 Query: 853 AIFFTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMKGCH*LWD 993 A+ FT+TWCGPCR I P +VEL+KKFP++ FLK+DV+E++ WD Sbjct: 30 AVDFTATWCGPCRVIGPVFVELSKKFPEIFFLKVDVDELRDVAQEWD 76 >gb|PKA46943.1| Thioredoxin H-type 2 [Apostasia shenzhenica] Length = 114 Score = 67.4 bits (163), Expect = 3e-10 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +1 Query: 850 AAIFFTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMK 972 A + FT++WCGPCR IAP + ELAKKFP+V+FLK+DV+E+K Sbjct: 30 AVVDFTASWCGPCRMIAPIFAELAKKFPNVIFLKVDVDELK 70 >gb|PKU63496.1| Thioredoxin H1 [Dendrobium catenatum] Length = 115 Score = 67.4 bits (163), Expect = 3e-10 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +1 Query: 850 AAIFFTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMK 972 A + FT+TWCGPCR IAP + +LAKKFP+V+FLK+DV+E+K Sbjct: 30 AVVDFTATWCGPCRTIAPIFADLAKKFPNVLFLKVDVDELK 70 >ref|XP_020590107.1| thioredoxin H1 [Phalaenopsis equestris] Length = 115 Score = 67.4 bits (163), Expect = 3e-10 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +1 Query: 850 AAIFFTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMK 972 A + FT++WCGPCR IAP + ELAKKFP+V+FLK+DV+E+K Sbjct: 30 AVVDFTASWCGPCRTIAPIFTELAKKFPEVLFLKVDVDELK 70 >gb|ABK24945.1| unknown [Picea sitchensis] gb|ABK25545.1| unknown [Picea sitchensis] Length = 123 Score = 67.0 bits (162), Expect = 5e-10 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = +1 Query: 862 FTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMKGCH*LWD 993 FT+TWCGPCR I+P +VEL+KKFP++ FLK+DV+E++ WD Sbjct: 33 FTATWCGPCRVISPVFVELSKKFPEIFFLKVDVDELRDVAQEWD 76 >gb|OAY74795.1| Thioredoxin H1 [Ananas comosus] Length = 112 Score = 66.6 bits (161), Expect = 5e-10 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = +1 Query: 862 FTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMKGCH*LWD 993 FT++WCGPCR IAP + E AKK+P VVFLK+DV+E+KG W+ Sbjct: 34 FTASWCGPCRMIAPVFAEFAKKYPGVVFLKVDVDELKGVAREWE 77 >ref|XP_020091655.1| thioredoxin H1-like [Ananas comosus] Length = 114 Score = 66.6 bits (161), Expect = 5e-10 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = +1 Query: 862 FTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMKGCH*LWD 993 FT++WCGPCR IAP + E AKK+P VVFLK+DV+E+KG W+ Sbjct: 34 FTASWCGPCRMIAPVFAEFAKKYPGVVFLKVDVDELKGVAREWE 77 >ref|XP_020677622.1| thioredoxin H1-like [Dendrobium catenatum] Length = 147 Score = 67.4 bits (163), Expect = 6e-10 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +1 Query: 850 AAIFFTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMK 972 A + FT+TWCGPCR IAP + +LAKKFP+V+FLK+DV+E+K Sbjct: 62 AVVDFTATWCGPCRTIAPIFADLAKKFPNVLFLKVDVDELK 102 >ref|XP_019245244.1| PREDICTED: thioredoxin H-type 1-like [Nicotiana attenuata] gb|OIT04002.1| thioredoxin h-type 1 [Nicotiana attenuata] Length = 113 Score = 66.2 bits (160), Expect = 7e-10 Identities = 30/69 (43%), Positives = 43/69 (62%) Frame = +1 Query: 787 SDSITLLQFSFYLTVIALWL*AAIFFTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNE 966 S + L YL +LW+ + FT++WCGPCR IAP ++AKK P V+FLK+DV+E Sbjct: 5 SCDLLYLTLLIYLVAASLWV--VVDFTASWCGPCRFIAPILADIAKKMPHVIFLKVDVDE 62 Query: 967 MKGCH*LWD 993 +K W+ Sbjct: 63 LKSVFEEWN 71 >ref|XP_020257567.1| thioredoxin H1-like [Asparagus officinalis] gb|ONK75739.1| uncharacterized protein A4U43_C03F20030 [Asparagus officinalis] Length = 110 Score = 65.9 bits (159), Expect = 9e-10 Identities = 26/46 (56%), Positives = 36/46 (78%) Frame = +1 Query: 856 IFFTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMKGCH*LWD 993 ++FT+TWCGPCR + P Y ELAKK+ VVFLK+DV+E++G W+ Sbjct: 30 VYFTATWCGPCRMMGPIYAELAKKYAGVVFLKVDVDELEGVAKEWE 75 >ref|XP_023749634.1| thioredoxin H1-like [Lactuca sativa] gb|PLY61702.1| hypothetical protein LSAT_5X99920 [Lactuca sativa] Length = 118 Score = 65.9 bits (159), Expect = 1e-09 Identities = 25/37 (67%), Positives = 34/37 (91%) Frame = +1 Query: 862 FTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMK 972 FT++WCGPCR +AP + ELAKKFPDV+F+K+DV+E+K Sbjct: 36 FTASWCGPCRMMAPIFAELAKKFPDVIFVKIDVDELK 72 >gb|ABK23262.1| unknown [Picea sitchensis] Length = 120 Score = 65.5 bits (158), Expect = 1e-09 Identities = 25/44 (56%), Positives = 35/44 (79%) Frame = +1 Query: 862 FTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMKGCH*LWD 993 FT+TWCGPCR I P +VEL+KKFP++ FLK+DV++++ WD Sbjct: 33 FTATWCGPCRVIGPVFVELSKKFPEIFFLKVDVDQLRDVAQEWD 76 >gb|ABK21322.1| unknown [Picea sitchensis] gb|ABK24947.1| unknown [Picea sitchensis] gb|ABK24960.1| unknown [Picea sitchensis] gb|ABK25739.1| unknown [Picea sitchensis] gb|ABR16310.1| unknown [Picea sitchensis] Length = 120 Score = 65.5 bits (158), Expect = 1e-09 Identities = 25/44 (56%), Positives = 35/44 (79%) Frame = +1 Query: 862 FTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMKGCH*LWD 993 FT+TWCGPCR I P +VEL+KKFP++ FLK+DV++++ WD Sbjct: 33 FTATWCGPCRVIGPVFVELSKKFPEIFFLKVDVDQLRDVAQEWD 76 >gb|OAE18646.1| hypothetical protein AXG93_3810s1150 [Marchantia polymorpha subsp. ruderalis] Length = 114 Score = 65.1 bits (157), Expect = 2e-09 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = +1 Query: 862 FTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMKGCH*LWD 993 FT+TWCGPCR +AP +VEL+KK+P +VFLK+DV+++ LWD Sbjct: 32 FTATWCGPCRHMAPVFVELSKKYPSLVFLKVDVDQVTEVAGLWD 75 >gb|OIC62575.1| hypothetical protein A7L55_18720 [Acinetobacter baumannii] gb|OID74000.1| hypothetical protein A7L74_19140 [Acinetobacter baumannii] Length = 102 Score = 64.7 bits (156), Expect = 2e-09 Identities = 24/44 (54%), Positives = 36/44 (81%) Frame = +1 Query: 862 FTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMKGCH*LWD 993 FT+TWCGPCR I+P +VEL+++FP++ FLK+DV+E++ WD Sbjct: 15 FTATWCGPCRVISPVFVELSRRFPEIFFLKVDVDELRDVAQEWD 58 >ref|XP_017699037.1| PREDICTED: thioredoxin H1-like [Phoenix dactylifera] Length = 76 Score = 63.5 bits (153), Expect = 2e-09 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +1 Query: 856 IFFTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMK 972 I FT++WCGPCR IAP + ELAKKF +V+FLK+DV+E+K Sbjct: 30 IDFTASWCGPCRMIAPVFAELAKKFTNVIFLKVDVDELK 68 >ref|XP_009398388.1| PREDICTED: thioredoxin H1-like [Musa acuminata subsp. malaccensis] Length = 114 Score = 64.7 bits (156), Expect = 2e-09 Identities = 25/39 (64%), Positives = 36/39 (92%) Frame = +1 Query: 856 IFFTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMK 972 I FT++WCGPCRAIAP + +LAK++P+V+FLK+DV+E+K Sbjct: 32 IDFTASWCGPCRAIAPIFADLAKRYPNVIFLKVDVDELK 70 >gb|PAN09877.1| hypothetical protein PAHAL_B00927 [Panicum hallii] Length = 120 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +1 Query: 856 IFFTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMK 972 I FT++WCGPCR IAP +VE AKKFP VFLK+DV+E+K Sbjct: 33 IDFTASWCGPCRVIAPVFVEYAKKFPGAVFLKVDVDELK 71 >ref|WP_082177828.1| thioredoxin [Acinetobacter baumannii] Length = 120 Score = 64.7 bits (156), Expect = 3e-09 Identities = 24/44 (54%), Positives = 36/44 (81%) Frame = +1 Query: 862 FTSTWCGPCRAIAPAYVELAKKFPDVVFLKLDVNEMKGCH*LWD 993 FT+TWCGPCR I+P +VEL+++FP++ FLK+DV+E++ WD Sbjct: 33 FTATWCGPCRVISPVFVELSRRFPEIFFLKVDVDELRDVAQEWD 76