BLASTX nr result
ID: Cheilocostus21_contig00024796
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00024796 (688 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010928441.1| PREDICTED: polygalacturonase inhibitor-like ... 99 1e-20 ref|XP_008795755.1| PREDICTED: polygalacturonase inhibitor-like ... 96 8e-20 gb|OAY84335.1| Polygalacturonase inhibitor [Ananas comosus] 84 2e-15 ref|XP_020090304.1| polygalacturonase inhibitor 1-like [Ananas c... 84 2e-15 gb|PKA51326.1| Polygalacturonase inhibitor 1 [Apostasia shenzhen... 83 7e-15 ref|XP_020597565.1| polygalacturonase inhibitor 2-like [Phalaeno... 80 4e-14 gb|PKU75415.1| Polygalacturonase inhibitor [Dendrobium catenatum] 78 3e-13 ref|XP_020691282.1| LRR receptor-like serine/threonine-protein k... 78 6e-13 gb|OEL24482.1| Polygalacturonase inhibitor [Dichanthelium oligos... 76 3e-12 gb|PKU75414.1| Polygalacturonase inhibitor 2 [Dendrobium catenatum] 75 3e-12 ref|XP_020692272.1| polygalacturonase inhibitor 2-like [Dendrobi... 75 6e-12 gb|PAN16761.1| hypothetical protein PAHAL_C00981 [Panicum hallii] 74 6e-12 gb|PAN16762.1| hypothetical protein PAHAL_C00982 [Panicum hallii] 74 6e-12 gb|ACG26254.1| polygalacturonase inhibitor precursor [Zea mays] 74 7e-12 ref|NP_001147231.2| polygalacturonase inhibitor precursor [Zea m... 74 7e-12 ref|XP_002439099.1| polygalacturonase inhibitor [Sorghum bicolor... 74 9e-12 gb|KQL13456.1| hypothetical protein SETIT_024946mg [Setaria ital... 74 1e-11 ref|XP_004963458.2| polygalacturonase inhibitor [Setaria italica] 74 1e-11 ref|XP_004960588.1| polygalacturonase inhibitor [Setaria italica] 73 2e-11 ref|XP_023517556.1| polygalacturonase inhibitor-like [Cucurbita ... 72 3e-11 >ref|XP_010928441.1| PREDICTED: polygalacturonase inhibitor-like [Elaeis guineensis] Length = 335 Score = 98.6 bits (244), Expect = 1e-20 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +2 Query: 548 PASAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 685 P S+A CNK+DKKAL+A+KAAFNNAYHFASWTNDTGCCDWYDVDCD Sbjct: 25 PVSSARCNKDDKKALLAVKAAFNNAYHFASWTNDTGCCDWYDVDCD 70 >ref|XP_008795755.1| PREDICTED: polygalacturonase inhibitor-like [Phoenix dactylifera] Length = 336 Score = 96.3 bits (238), Expect = 8e-20 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +2 Query: 554 SAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 685 S+A CNK+DKKAL+AIKAAFNNAYHFASWTNDTGCCDWYDVDCD Sbjct: 27 SSARCNKDDKKALLAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 70 >gb|OAY84335.1| Polygalacturonase inhibitor [Ananas comosus] Length = 334 Score = 84.0 bits (206), Expect = 2e-15 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = +2 Query: 551 ASAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 685 ASA CN +DKKAL+AIKAAFNNAYHFASW CCDWYDVDCD Sbjct: 23 ASAGRCNSDDKKALLAIKAAFNNAYHFASWVPSAACCDWYDVDCD 67 >ref|XP_020090304.1| polygalacturonase inhibitor 1-like [Ananas comosus] Length = 335 Score = 84.0 bits (206), Expect = 2e-15 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = +2 Query: 551 ASAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 685 ASA CN +DKKAL+AIKAAFNNAYHFASW CCDWYDVDCD Sbjct: 23 ASAGRCNSDDKKALLAIKAAFNNAYHFASWVPSAACCDWYDVDCD 67 >gb|PKA51326.1| Polygalacturonase inhibitor 1 [Apostasia shenzhenica] Length = 350 Score = 82.8 bits (203), Expect = 7e-15 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = +2 Query: 551 ASAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 685 A+A CNK+DK+AL+AIK+AFNNAYHFASWTN + CCDWY ++CD Sbjct: 33 AAAGKCNKDDKRALLAIKSAFNNAYHFASWTNTSACCDWYGIECD 77 >ref|XP_020597565.1| polygalacturonase inhibitor 2-like [Phalaenopsis equestris] Length = 342 Score = 80.5 bits (197), Expect = 4e-14 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = +2 Query: 554 SAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 685 +A CNKNDK+ALI+IK+AFNNAYHFASWT+ + CCDWY V+CD Sbjct: 19 TADKCNKNDKRALISIKSAFNNAYHFASWTSTSACCDWYGVECD 62 >gb|PKU75415.1| Polygalacturonase inhibitor [Dendrobium catenatum] Length = 339 Score = 78.2 bits (191), Expect = 3e-13 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = +2 Query: 554 SAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 685 +A CNK DK+ALI+IK+AFNNAYHFASWT+ + CCDWY V+CD Sbjct: 19 AADKCNKEDKRALISIKSAFNNAYHFASWTSTSACCDWYGVECD 62 >ref|XP_020691282.1| LRR receptor-like serine/threonine-protein kinase GSO2 [Dendrobium catenatum] Length = 709 Score = 78.2 bits (191), Expect = 6e-13 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = +2 Query: 554 SAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 685 +A CNK DK+ALI+IK+AFNNAYHFASWT+ + CCDWY V+CD Sbjct: 19 AADKCNKEDKRALISIKSAFNNAYHFASWTSTSACCDWYGVECD 62 Score = 75.1 bits (183), Expect = 7e-12 Identities = 28/44 (63%), Positives = 38/44 (86%) Frame = +2 Query: 554 SAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 685 +A CNK DK+AL++IK+AFNNAYHFASWT+ + CC+WY ++CD Sbjct: 390 AADKCNKYDKRALLSIKSAFNNAYHFASWTSSSACCEWYGIECD 433 >gb|OEL24482.1| Polygalacturonase inhibitor [Dichanthelium oligosanthes] Length = 734 Score = 76.3 bits (186), Expect = 3e-12 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +2 Query: 551 ASAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 685 A+++ C+ DK AL+AIKAA N YHFASWT DT CCDWYDVDCD Sbjct: 423 AASSPCHSGDKSALLAIKAALGNPYHFASWTPDTPCCDWYDVDCD 467 Score = 67.4 bits (163), Expect = 3e-09 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = +2 Query: 551 ASAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 685 AS C+ D+ AL+A+ A + YHFASWT DT CCDWYDVDCD Sbjct: 31 ASTMQCHDEDQAALLAVSDALGSPYHFASWTPDTFCCDWYDVDCD 75 >gb|PKU75414.1| Polygalacturonase inhibitor 2 [Dendrobium catenatum] Length = 336 Score = 75.1 bits (183), Expect = 3e-12 Identities = 28/44 (63%), Positives = 38/44 (86%) Frame = +2 Query: 554 SAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 685 +A CNK DK+AL++IK+AFNNAYHFASWT+ + CC+WY ++CD Sbjct: 17 AADKCNKYDKRALLSIKSAFNNAYHFASWTSSSACCEWYGIECD 60 >ref|XP_020692272.1| polygalacturonase inhibitor 2-like [Dendrobium catenatum] gb|PKU72566.1| Polygalacturonase inhibitor 1 [Dendrobium catenatum] Length = 379 Score = 74.7 bits (182), Expect = 6e-12 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = +2 Query: 554 SAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 685 +A CNK DK+AL++IK+AFNNAYHF SWT+ CCDWY ++CD Sbjct: 58 AADKCNKYDKRALLSIKSAFNNAYHFTSWTSSAACCDWYGIECD 101 >gb|PAN16761.1| hypothetical protein PAHAL_C00981 [Panicum hallii] Length = 334 Score = 74.3 bits (181), Expect = 6e-12 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = +2 Query: 551 ASAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCDA 688 +SA+ C+ DK AL+AIKAA N YHFASWT + CCDWYDVDCDA Sbjct: 23 SSASRCHSGDKAALLAIKAALGNPYHFASWTAASPCCDWYDVDCDA 68 >gb|PAN16762.1| hypothetical protein PAHAL_C00982 [Panicum hallii] Length = 335 Score = 74.3 bits (181), Expect = 6e-12 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +2 Query: 551 ASAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCDA 688 AS C+ DK AL+A+KAA N YHFASWT D CCDWYDVDCDA Sbjct: 24 ASKDRCHSGDKAALLAVKAALGNPYHFASWTPDDPCCDWYDVDCDA 69 >gb|ACG26254.1| polygalacturonase inhibitor precursor [Zea mays] Length = 341 Score = 74.3 bits (181), Expect = 7e-12 Identities = 34/48 (70%), Positives = 36/48 (75%), Gaps = 2/48 (4%) Frame = +2 Query: 551 ASAAL--CNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCDA 688 ASAA C+ DK AL+AIKAA N YHFASWT D CCDWYDVDCDA Sbjct: 25 ASAAKDRCHSGDKAALLAIKAALGNPYHFASWTPDNPCCDWYDVDCDA 72 >ref|NP_001147231.2| polygalacturonase inhibitor precursor [Zea mays] gb|AQK79617.1| Polygalacturonase inhibitor [Zea mays] Length = 341 Score = 74.3 bits (181), Expect = 7e-12 Identities = 34/48 (70%), Positives = 36/48 (75%), Gaps = 2/48 (4%) Frame = +2 Query: 551 ASAAL--CNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCDA 688 ASAA C+ DK AL+AIKAA N YHFASWT D CCDWYDVDCDA Sbjct: 25 ASAAKDRCHSGDKAALLAIKAALGNPYHFASWTPDNPCCDWYDVDCDA 72 >ref|XP_002439099.1| polygalacturonase inhibitor [Sorghum bicolor] gb|EES17529.1| hypothetical protein SORBI_3009G002600 [Sorghum bicolor] Length = 341 Score = 73.9 bits (180), Expect = 9e-12 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +2 Query: 566 CNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCDA 688 C+ DK AL+AIKAA N YHFASWT D CCDWYDVDCDA Sbjct: 34 CHSGDKAALLAIKAALGNPYHFASWTPDNPCCDWYDVDCDA 74 >gb|KQL13456.1| hypothetical protein SETIT_024946mg [Setaria italica] Length = 327 Score = 73.6 bits (179), Expect = 1e-11 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = +2 Query: 551 ASAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 685 A+++ C+ DK AL+AIKAA N YHFASWT T CCDWYDVDCD Sbjct: 16 AASSRCHSGDKAALLAIKAALGNPYHFASWTPGTPCCDWYDVDCD 60 >ref|XP_004963458.2| polygalacturonase inhibitor [Setaria italica] Length = 335 Score = 73.6 bits (179), Expect = 1e-11 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = +2 Query: 551 ASAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 685 A+++ C+ DK AL+AIKAA N YHFASWT T CCDWYDVDCD Sbjct: 24 AASSRCHSGDKAALLAIKAALGNPYHFASWTPGTPCCDWYDVDCD 68 >ref|XP_004960588.1| polygalacturonase inhibitor [Setaria italica] Length = 337 Score = 73.2 bits (178), Expect = 2e-11 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = +2 Query: 551 ASAALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 685 AS A C+ D AL+AIKAA N YHFASWT D CCDWYDVDCD Sbjct: 26 ASKARCHSGDNAALLAIKAALGNPYHFASWTPDYPCCDWYDVDCD 70 >ref|XP_023517556.1| polygalacturonase inhibitor-like [Cucurbita pepo subsp. pepo] Length = 336 Score = 72.4 bits (176), Expect = 3e-11 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = +2 Query: 557 AALCNKNDKKALIAIKAAFNNAYHFASWTNDTGCCDWYDVDCD 685 A LCN NDKKAL+ IK AFNNAY+FASW + CC WY VDCD Sbjct: 28 AELCNPNDKKALLNIKKAFNNAYYFASWKPEEDCCTWYSVDCD 70