BLASTX nr result
ID: Cheilocostus21_contig00024763
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00024763 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ALO24228.1| nicotianamine synthase [Musa AAB Group] 56 3e-06 ref|XP_009384425.1| PREDICTED: nicotianamine synthase 3-like [Mu... 56 3e-06 >gb|ALO24228.1| nicotianamine synthase [Musa AAB Group] Length = 315 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +1 Query: 1 AAVMRPCKCCEMVQGLQYHFGAHGSIMDQEVGLEELPS 114 AAVMRPCKCCEM+QG +HFG HGS+M +EV LEELPS Sbjct: 281 AAVMRPCKCCEMMQGF-HHFG-HGSMM-EEVALEELPS 315 >ref|XP_009384425.1| PREDICTED: nicotianamine synthase 3-like [Musa acuminata subsp. malaccensis] Length = 320 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +1 Query: 1 AAVMRPCKCCEMVQGLQYHFGAHGSIMDQEVGLEELPS 114 AAVMRPCKCCEM+QG +HFG HGS+M +EV LEELPS Sbjct: 286 AAVMRPCKCCEMMQGF-HHFG-HGSMM-EEVALEELPS 320