BLASTX nr result
ID: Cheilocostus21_contig00024383
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00024383 (1015 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583... 79 4e-15 ref|XP_015576248.1| PREDICTED: uncharacterized protein LOC107261... 78 5e-15 ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763... 78 7e-15 gb|OAY57449.1| hypothetical protein MANES_02G097800 [Manihot esc... 76 4e-14 ref|XP_016696981.1| PREDICTED: uncharacterized protein LOC107913... 76 4e-14 gb|PIA52775.1| hypothetical protein AQUCO_01000560v1 [Aquilegia ... 75 5e-14 ref|XP_008241732.2| PREDICTED: uncharacterized protein LOC103340... 75 5e-14 ref|XP_016899222.1| PREDICTED: uncharacterized protein LOC107990... 75 9e-14 ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128... 75 9e-14 ref|XP_008784952.1| PREDICTED: uncharacterized protein LOC103703... 75 9e-14 ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624... 74 1e-13 ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 74 2e-13 ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240... 74 2e-13 ref|XP_017429722.1| PREDICTED: uncharacterized protein LOC108337... 74 2e-13 ref|XP_016682625.1| PREDICTED: uncharacterized protein LOC107901... 74 2e-13 ref|XP_016723134.1| PREDICTED: uncharacterized protein LOC107935... 73 3e-13 ref|XP_016449674.1| PREDICTED: uncharacterized protein LOC107774... 73 3e-13 ref|XP_015063650.1| PREDICTED: uncharacterized protein LOC107008... 73 5e-13 ref|XP_016479999.1| PREDICTED: uncharacterized protein LOC107801... 73 5e-13 gb|PIN23011.1| hypothetical protein CDL12_04270 [Handroanthus im... 72 7e-13 >ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583416 [Brachypodium distachyon] ref|XP_015622691.1| PREDICTED: uncharacterized protein LOC107279891 [Oryza sativa Japonica Group] ref|XP_015890019.1| PREDICTED: uncharacterized protein LOC107424684 [Ziziphus jujuba] gb|KQJ93156.1| hypothetical protein BRADI_3g02990v3 [Brachypodium distachyon] gb|KXG29403.1| hypothetical protein SORBI_3004G031200 [Sorghum bicolor] gb|OEL36113.1| hypothetical protein BAE44_0002863 [Dichanthelium oligosanthes] gb|PAN03873.1| hypothetical protein PAHAL_A00206 [Panicum hallii] Length = 41 Score = 78.6 bits (192), Expect = 4e-15 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS +ISEILLSGFMINSTLR RTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVISEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_015576248.1| PREDICTED: uncharacterized protein LOC107261451 [Ricinus communis] Length = 41 Score = 78.2 bits (191), Expect = 5e-15 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS ++SEILLSGFMINSTLR RTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVVSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763252 [Gossypium raimondii] ref|XP_016723474.1| PREDICTED: uncharacterized protein LOC107935386 [Gossypium hirsutum] ref|XP_016735458.1| PREDICTED: uncharacterized protein LOC107945825 [Gossypium hirsutum] ref|XP_017637265.1| PREDICTED: uncharacterized protein LOC108479277 [Gossypium arboreum] ref|XP_017970110.1| PREDICTED: uncharacterized protein LOC108660570 [Theobroma cacao] Length = 41 Score = 77.8 bits (190), Expect = 7e-15 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS ++SEILLSGFMINSTLR RTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >gb|OAY57449.1| hypothetical protein MANES_02G097800 [Manihot esculenta] Length = 41 Score = 75.9 bits (185), Expect = 4e-14 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS ++ EILLSGFMINSTLR RTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLCEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_016696981.1| PREDICTED: uncharacterized protein LOC107913053 [Gossypium hirsutum] Length = 41 Score = 75.9 bits (185), Expect = 4e-14 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS ++SEILLSG MINSTLR RTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVVSEILLSGLMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >gb|PIA52775.1| hypothetical protein AQUCO_01000560v1 [Aquilegia coerulea] Length = 41 Score = 75.5 bits (184), Expect = 5e-14 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS ++SEILL GFMINSTLR RTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILLLGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_008241732.2| PREDICTED: uncharacterized protein LOC103340134 [Prunus mume] gb|ONH96935.1| hypothetical protein PRUPE_7G160500 [Prunus persica] Length = 41 Score = 75.5 bits (184), Expect = 5e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS ++SEILLSGFM+NSTLR RTHLVQSFSV FLYWFYVFS Sbjct: 1 MSPVLSEILLSGFMVNSTLRRRTHLVQSFSVCFLYWFYVFS 41 >ref|XP_016899222.1| PREDICTED: uncharacterized protein LOC107990447 [Cucumis melo] Length = 41 Score = 74.7 bits (182), Expect = 9e-14 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS +++E+LLSGF++NSTLR RTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVVTEVLLSGFIVNSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128494 [Populus euphratica] Length = 41 Score = 74.7 bits (182), Expect = 9e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 M+ ++ EILLSGFMINSTLR RTHLVQSFSVVFLYWFYVFS Sbjct: 1 MTPVLCEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_008784952.1| PREDICTED: uncharacterized protein LOC103703760 [Phoenix dactylifera] ref|XP_008795970.1| PREDICTED: uncharacterized protein LOC103711555 [Phoenix dactylifera] Length = 41 Score = 74.7 bits (182), Expect = 9e-14 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS I+SEILLSGFMI+S+LR RTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGFMISSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624295 [Citrus sinensis] ref|XP_016748736.1| PREDICTED: uncharacterized protein LOC107957695 [Gossypium hirsutum] ref|XP_016749064.1| PREDICTED: uncharacterized protein LOC107957944 [Gossypium hirsutum] ref|XP_016687605.1| PREDICTED: uncharacterized protein LOC107905459 [Gossypium hirsutum] ref|XP_017621252.1| PREDICTED: uncharacterized protein LOC108465439 [Gossypium arboreum] ref|XP_017608544.1| PREDICTED: uncharacterized protein LOC108454556 [Gossypium arboreum] ref|XP_017981825.1| PREDICTED: uncharacterized protein LOC18591442 [Theobroma cacao] gb|EOY14848.1| Peptide upstream open reading frame 5 [Theobroma cacao] gb|PNT47556.1| hypothetical protein POPTR_002G032000v3 [Populus trichocarpa] Length = 41 Score = 74.3 bits (181), Expect = 1e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS ++SEIL SGFMINS+LR RTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVVSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] ref|XP_007160725.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] ref|XP_015576833.1| PREDICTED: uncharacterized protein LOC107261510 [Ricinus communis] gb|ESW32719.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] gb|KMT20717.1| hypothetical protein BVRB_1g006920 [Beta vulgaris subsp. vulgaris] gb|KRH15150.1| hypothetical protein GLYMA_14G071500 [Glycine max] gb|OAY21340.1| hypothetical protein MANES_S096000 [Manihot esculenta] gb|OAY21592.1| hypothetical protein MANES_S074500 [Manihot esculenta] Length = 41 Score = 73.9 bits (180), Expect = 2e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS ++SEIL SGFMINS+LR RTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240532 [Nicotiana sylvestris] ref|XP_016501595.1| PREDICTED: uncharacterized protein LOC107819919 [Nicotiana tabacum] Length = 45 Score = 73.9 bits (180), Expect = 2e-13 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS +ISE+LLSGF INSTL RTHLVQSFSVVFLYWFYVFS Sbjct: 5 MSPVISEVLLSGFTINSTLHRRTHLVQSFSVVFLYWFYVFS 45 >ref|XP_017429722.1| PREDICTED: uncharacterized protein LOC108337663 [Vigna angularis] Length = 41 Score = 73.6 bits (179), Expect = 2e-13 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS ++SEIL SGFMINS+LR RTHLVQSFSV+FLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVIFLYWFYVFS 41 >ref|XP_016682625.1| PREDICTED: uncharacterized protein LOC107901221 [Gossypium hirsutum] ref|XP_017629680.1| PREDICTED: uncharacterized protein LOC108472643 [Gossypium arboreum] Length = 41 Score = 73.6 bits (179), Expect = 2e-13 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS ++ EILLSG MINSTLR RTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLCEILLSGLMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_016723134.1| PREDICTED: uncharacterized protein LOC107935090 [Gossypium hirsutum] Length = 41 Score = 73.2 bits (178), Expect = 3e-13 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS ++SEIL SGFMINS+LR RTHL+QSFSVVFLYWFYVFS Sbjct: 1 MSPVVSEILRSGFMINSSLRRRTHLLQSFSVVFLYWFYVFS 41 >ref|XP_016449674.1| PREDICTED: uncharacterized protein LOC107774598 [Nicotiana tabacum] ref|XP_016560686.1| PREDICTED: uncharacterized protein LOC107860005 [Capsicum annuum] gb|PHT56622.1| hypothetical protein CQW23_05108 [Capsicum baccatum] gb|PHT91271.1| hypothetical protein T459_06384 [Capsicum annuum] gb|PHU27074.1| hypothetical protein BC332_05406 [Capsicum chinense] Length = 41 Score = 73.2 bits (178), Expect = 3e-13 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS +ISE+LLSGF INSTLR THLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVISEVLLSGFTINSTLRRGTHLVQSFSVVFLYWFYVFS 41 >ref|XP_015063650.1| PREDICTED: uncharacterized protein LOC107008942 [Solanum pennellii] Length = 41 Score = 72.8 bits (177), Expect = 5e-13 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 M ++ISE+LLSGF++NSTL RTHLVQSFSVVFLYWFYVFS Sbjct: 1 MYSVISEVLLSGFIVNSTLHRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_016479999.1| PREDICTED: uncharacterized protein LOC107801228 [Nicotiana tabacum] Length = 45 Score = 72.8 bits (177), Expect = 5e-13 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS +ISE+LLSGF +NSTL RTHLVQSFSVVFLYWFYVFS Sbjct: 5 MSPVISEVLLSGFTMNSTLHRRTHLVQSFSVVFLYWFYVFS 45 >gb|PIN23011.1| hypothetical protein CDL12_04270 [Handroanthus impetiginosus] Length = 41 Score = 72.4 bits (176), Expect = 7e-13 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -3 Query: 422 MSAIISEILLSGFMINSTLRSRTHLVQSFSVVFLYWFYVFS 300 MS ++SEIL SGF+INS+LR RTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFIINSSLRRRTHLVQSFSVVFLYWFYVFS 41