BLASTX nr result
ID: Cheilocostus21_contig00024321
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00024321 (554 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009406706.1| PREDICTED: protein TIFY 5A-like [Musa acumin... 52 6e-06 ref|XP_009418985.1| PREDICTED: protein TIFY 5A-like [Musa acumin... 54 1e-05 >ref|XP_009406706.1| PREDICTED: protein TIFY 5A-like [Musa acuminata subsp. malaccensis] Length = 149 Score = 51.6 bits (122), Expect(2) = 6e-06 Identities = 30/52 (57%), Positives = 38/52 (73%) Frame = -2 Query: 322 SGSALHQPPAPALSPQAIPQLLNPGLSMKRSLQRFLQIMKRRAFVRHLVPCS 167 S S+L +PP SP+ +PQ+LNPGLSMKRSLQRFLQ KR+A + + P S Sbjct: 89 STSSLPRPP----SPRPMPQMLNPGLSMKRSLQRFLQ--KRKARMNDVSPYS 134 Score = 26.2 bits (56), Expect(2) = 6e-06 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 467 QNKQQMTILHNGRDCV 420 +N+QQMTI ++GR CV Sbjct: 36 RNQQQMTIFYDGRVCV 51 >ref|XP_009418985.1| PREDICTED: protein TIFY 5A-like [Musa acuminata subsp. malaccensis] Length = 147 Score = 53.5 bits (127), Expect = 1e-05 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -2 Query: 304 QPPAPALSPQAIPQLLNPGLSMKRSLQRFLQIMKRRAFVRHLVP 173 QP AP PQA+PQ+LNPGLSMKRSLQRFLQ KR+A + + P Sbjct: 91 QPTAPP-PPQAVPQILNPGLSMKRSLQRFLQ--KRKARISDVSP 131