BLASTX nr result
ID: Cheilocostus21_contig00024015
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00024015 (971 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009392967.2| PREDICTED: cysteine synthase 2 [Musa acumina... 112 4e-24 gb|ONL95103.1| Pyridoxal-5'-phosphate-dependent enzyme family pr... 104 1e-22 ref|XP_023924844.1| cysteine synthase 2 isoform X2 [Quercus sube... 107 2e-22 ref|XP_023924843.1| cysteine synthase 2 isoform X1 [Quercus suber] 107 2e-22 ref|XP_008785644.1| PREDICTED: cysteine synthase 2 [Phoenix dact... 107 2e-22 ref|XP_023900340.1| cysteine synthase 2-like [Quercus suber] >gi... 107 3e-22 ref|NP_001338998.1| uncharacterized protein LOC100193476 [Zea ma... 104 3e-22 gb|ONL95102.1| Pyridoxal-5'-phosphate-dependent enzyme family pr... 104 3e-22 ref|XP_020174244.1| cysteine synthase 2 [Aegilops tauschii subsp... 106 3e-22 ref|XP_022039530.1| cysteine synthase 2 [Helianthus annuus] >gi|... 106 4e-22 ref|XP_007142415.1| hypothetical protein PHAVU_008G278600g [Phas... 105 5e-22 gb|POE87200.1| cysteine synthase 2 [Quercus suber] 99 7e-22 gb|EEF39609.1| cysteine synthase, putative [Ricinus communis] 103 7e-22 ref|XP_009777031.1| PREDICTED: cysteine synthase 2 isoform X2 [N... 103 9e-22 gb|OEL15766.1| Cysteine synthase 2 [Dichanthelium oligosanthes] 105 1e-21 ref|XP_004985185.1| cysteine synthase [Setaria italica] >gi|9442... 105 1e-21 gb|PAN50867.1| hypothetical protein PAHAL_I00992 [Panicum hallii] 105 1e-21 ref|XP_015577011.1| PREDICTED: cysteine synthase [Ricinus communis] 103 1e-21 ref|XP_023753872.1| cysteine synthase 2 [Lactuca sativa] >gi|132... 104 2e-21 ref|XP_020241756.1| cysteine synthase 2 [Asparagus officinalis] 104 2e-21 >ref|XP_009392967.2| PREDICTED: cysteine synthase 2 [Musa acuminata subsp. malaccensis] Length = 449 Score = 112 bits (279), Expect = 4e-24 Identities = 52/59 (88%), Positives = 54/59 (91%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFLDSS 319 AMNCVGAVRLARSLGPGHTI+TILCDSGMRHLSKFCNA+YL HGLTPTA LEFLD S Sbjct: 391 AMNCVGAVRLARSLGPGHTIVTILCDSGMRHLSKFCNAQYLVDHGLTPTATNLEFLDHS 449 >gb|ONL95103.1| Pyridoxal-5'-phosphate-dependent enzyme family protein [Zea mays] Length = 246 Score = 104 bits (259), Expect = 1e-22 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFLD 313 AMNCVGAVR+A+ LGPGHTI+TILCDSGMRHLSKF N +YLA HGLTPTA GLEFLD Sbjct: 189 AMNCVGAVRVAQDLGPGHTIVTILCDSGMRHLSKFFNEQYLADHGLTPTATGLEFLD 245 >ref|XP_023924844.1| cysteine synthase 2 isoform X2 [Quercus suber] gb|POE95337.1| cysteine synthase 2 [Quercus suber] Length = 423 Score = 107 bits (266), Expect = 2e-22 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFL 310 AMNCVGAVR+A+S+GPGHTI+TILCDSGMRHLSKFCNAEYL+ HGLTP A GLEFL Sbjct: 365 AMNCVGAVRVAQSIGPGHTIVTILCDSGMRHLSKFCNAEYLSQHGLTPKATGLEFL 420 >ref|XP_023924843.1| cysteine synthase 2 isoform X1 [Quercus suber] Length = 429 Score = 107 bits (266), Expect = 2e-22 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFL 310 AMNCVGAVR+A+S+GPGHTI+TILCDSGMRHLSKFCNAEYL+ HGLTP A GLEFL Sbjct: 371 AMNCVGAVRVAQSIGPGHTIVTILCDSGMRHLSKFCNAEYLSQHGLTPKATGLEFL 426 >ref|XP_008785644.1| PREDICTED: cysteine synthase 2 [Phoenix dactylifera] Length = 438 Score = 107 bits (266), Expect = 2e-22 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFLD 313 AMNCVGAVRLA+SLGPGHTI+TILCDSGMRHLSKF NA+YLA HGLTP+A GLEFLD Sbjct: 380 AMNCVGAVRLAQSLGPGHTIVTILCDSGMRHLSKFHNAQYLADHGLTPSATGLEFLD 436 >ref|XP_023900340.1| cysteine synthase 2-like [Quercus suber] gb|POF20646.1| cysteine synthase 2 [Quercus suber] Length = 445 Score = 107 bits (266), Expect = 3e-22 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFL 310 AMNCVGAVR+A+S+GPGHTI+TILCDSGMRHLSKFCNAEYL+ HGLTP A GLEFL Sbjct: 340 AMNCVGAVRVAQSIGPGHTIVTILCDSGMRHLSKFCNAEYLSQHGLTPKATGLEFL 395 >ref|NP_001338998.1| uncharacterized protein LOC100193476 [Zea mays] gb|ONL95099.1| Pyridoxal-5'-phosphate-dependent enzyme family protein [Zea mays] Length = 283 Score = 104 bits (259), Expect = 3e-22 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFLD 313 AMNCVGAVR+A+ LGPGHTI+TILCDSGMRHLSKF N +YLA HGLTPTA GLEFLD Sbjct: 226 AMNCVGAVRVAQDLGPGHTIVTILCDSGMRHLSKFFNEQYLADHGLTPTATGLEFLD 282 >gb|ONL95102.1| Pyridoxal-5'-phosphate-dependent enzyme family protein [Zea mays] Length = 291 Score = 104 bits (259), Expect = 3e-22 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFLD 313 AMNCVGAVR+A+ LGPGHTI+TILCDSGMRHLSKF N +YLA HGLTPTA GLEFLD Sbjct: 234 AMNCVGAVRVAQDLGPGHTIVTILCDSGMRHLSKFFNEQYLADHGLTPTATGLEFLD 290 >ref|XP_020174244.1| cysteine synthase 2 [Aegilops tauschii subsp. tauschii] Length = 441 Score = 106 bits (265), Expect = 3e-22 Identities = 50/57 (87%), Positives = 52/57 (91%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFLD 313 AMNCVGAVR+AR LGPGHTI+TILCDSGMRHLSKF N EYLA HGLTPTA GLEFLD Sbjct: 384 AMNCVGAVRVARDLGPGHTIVTILCDSGMRHLSKFFNDEYLANHGLTPTATGLEFLD 440 >ref|XP_022039530.1| cysteine synthase 2 [Helianthus annuus] gb|OTG26551.1| putative pyridoxal-5'-phosphate-dependent enzyme family protein [Helianthus annuus] Length = 428 Score = 106 bits (264), Expect = 4e-22 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFLD 313 AMNCVGAVRLAR LGPGHT++TILCDSGMRHLSKFCN EYL+ HGLTP+A LEFLD Sbjct: 370 AMNCVGAVRLARLLGPGHTVVTILCDSGMRHLSKFCNPEYLSQHGLTPSAKALEFLD 426 >ref|XP_007142415.1| hypothetical protein PHAVU_008G278600g [Phaseolus vulgaris] gb|ESW14409.1| hypothetical protein PHAVU_008G278600g [Phaseolus vulgaris] Length = 422 Score = 105 bits (263), Expect = 5e-22 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFL 310 AMNCVGAVR+A+++GPGHTI+TILCDSGMRHLSKFCNAEYL+ GLTPTAAGLEFL Sbjct: 364 AMNCVGAVRVAQAIGPGHTIVTILCDSGMRHLSKFCNAEYLSGLGLTPTAAGLEFL 419 >gb|POE87200.1| cysteine synthase 2 [Quercus suber] Length = 114 Score = 98.6 bits (244), Expect = 7e-22 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFL 310 AMNCVGAVR+A+S+GPG TI+TILCDSGMRHLSKFCNAEYL+ HG P A GLEFL Sbjct: 56 AMNCVGAVRVAQSVGPGATIVTILCDSGMRHLSKFCNAEYLSQHGFPPKAIGLEFL 111 >gb|EEF39609.1| cysteine synthase, putative [Ricinus communis] Length = 297 Score = 103 bits (257), Expect = 7e-22 Identities = 47/56 (83%), Positives = 53/56 (94%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFL 310 AMNCVGAVR+A+++GPGHTI+TILCDSGMRHLSKF NAEYL+ HGLTPTA GLEFL Sbjct: 239 AMNCVGAVRVAQAIGPGHTIVTILCDSGMRHLSKFHNAEYLSQHGLTPTATGLEFL 294 >ref|XP_009777031.1| PREDICTED: cysteine synthase 2 isoform X2 [Nicotiana sylvestris] ref|XP_009777032.1| PREDICTED: cysteine synthase 2 isoform X2 [Nicotiana sylvestris] Length = 335 Score = 103 bits (258), Expect = 9e-22 Identities = 48/59 (81%), Positives = 54/59 (91%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFLDSS 319 AMNCVGAVR+A++LGPGHTI+TILCDSGMRHLSKF NAEYL+ HGLTP+A GLEFL S Sbjct: 277 AMNCVGAVRVAKALGPGHTIVTILCDSGMRHLSKFYNAEYLSEHGLTPSATGLEFLGLS 335 >gb|OEL15766.1| Cysteine synthase 2 [Dichanthelium oligosanthes] Length = 450 Score = 105 bits (262), Expect = 1e-21 Identities = 49/57 (85%), Positives = 52/57 (91%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFLD 313 AMNCVGAVR+AR LGPGHTI+TILCDSGMRHLSKF N +YLA HGLTPTA GLEFLD Sbjct: 393 AMNCVGAVRVARDLGPGHTIVTILCDSGMRHLSKFFNDQYLADHGLTPTATGLEFLD 449 >ref|XP_004985185.1| cysteine synthase [Setaria italica] gb|KQK91947.1| hypothetical protein SETIT_035656mg [Setaria italica] Length = 451 Score = 105 bits (262), Expect = 1e-21 Identities = 49/57 (85%), Positives = 52/57 (91%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFLD 313 AMNCVGAVR+AR LGPGHTI+TILCDSGMRHLSKF N +YLA HGLTPTA GLEFLD Sbjct: 394 AMNCVGAVRVARDLGPGHTIVTILCDSGMRHLSKFFNDQYLADHGLTPTATGLEFLD 450 >gb|PAN50867.1| hypothetical protein PAHAL_I00992 [Panicum hallii] Length = 454 Score = 105 bits (262), Expect = 1e-21 Identities = 49/57 (85%), Positives = 52/57 (91%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFLD 313 AMNCVGAVR+AR LGPGHTI+TILCDSGMRHLSKF N +YLA HGLTPTA GLEFLD Sbjct: 397 AMNCVGAVRVARDLGPGHTIVTILCDSGMRHLSKFFNDQYLADHGLTPTATGLEFLD 453 >ref|XP_015577011.1| PREDICTED: cysteine synthase [Ricinus communis] Length = 325 Score = 103 bits (257), Expect = 1e-21 Identities = 47/56 (83%), Positives = 53/56 (94%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFL 310 AMNCVGAVR+A+++GPGHTI+TILCDSGMRHLSKF NAEYL+ HGLTPTA GLEFL Sbjct: 267 AMNCVGAVRVAQAIGPGHTIVTILCDSGMRHLSKFHNAEYLSQHGLTPTATGLEFL 322 >ref|XP_023753872.1| cysteine synthase 2 [Lactuca sativa] gb|PLY93030.1| hypothetical protein LSAT_5X1441 [Lactuca sativa] Length = 398 Score = 104 bits (259), Expect = 2e-21 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFL 310 AMNCVGAVR+A+ LGPGHTI+TILCDSGMRHLSKFCN EYL+ HGLTP+A GLEFL Sbjct: 337 AMNCVGAVRVAKLLGPGHTIVTILCDSGMRHLSKFCNPEYLSQHGLTPSAKGLEFL 392 >ref|XP_020241756.1| cysteine synthase 2 [Asparagus officinalis] Length = 430 Score = 104 bits (260), Expect = 2e-21 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = +2 Query: 143 AMNCVGAVRLARSLGPGHTIITILCDSGMRHLSKFCNAEYLAAHGLTPTAAGLEFLD 313 AMNCVGAVRLARSLGPGHTI+TILCDSGMRHLSKF + +YLAAH LTP+A GLEFLD Sbjct: 372 AMNCVGAVRLARSLGPGHTIVTILCDSGMRHLSKFYHPQYLAAHDLTPSATGLEFLD 428