BLASTX nr result
ID: Cheilocostus21_contig00024012
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00024012 (473 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009400759.1| PREDICTED: uncharacterized protein LOC103984... 60 7e-09 ref|XP_018682002.1| PREDICTED: uncharacterized protein LOC103984... 58 3e-08 gb|PIA58649.1| hypothetical protein AQUCO_00500534v1 [Aquilegia ... 58 8e-08 gb|OVA02882.1| hypothetical protein BVC80_9095g77 [Macleaya cord... 57 1e-07 gb|PIA58648.1| hypothetical protein AQUCO_00500534v1 [Aquilegia ... 58 1e-07 ref|XP_008776694.1| PREDICTED: uncharacterized protein LOC103696... 57 2e-07 ref|XP_020528930.1| uncharacterized protein LOC18443805 isoform ... 55 9e-07 ref|XP_020597953.1| uncharacterized protein LOC110037604 [Phalae... 54 2e-06 ref|XP_010933437.2| PREDICTED: uncharacterized protein LOC105053... 55 3e-06 ref|XP_006854049.1| uncharacterized protein LOC18443805 isoform ... 53 5e-06 gb|PHT36574.1| hypothetical protein CQW23_24274 [Capsicum baccatum] 52 6e-06 gb|PHT58589.1| hypothetical protein CQW23_00952 [Capsicum baccat... 52 8e-06 ref|XP_019445281.1| PREDICTED: uncharacterized protein LOC109349... 52 8e-06 ref|XP_015085488.1| PREDICTED: uncharacterized protein LOC107028... 52 8e-06 ref|XP_004245995.1| PREDICTED: uncharacterized protein LOC101246... 52 8e-06 >ref|XP_009400759.1| PREDICTED: uncharacterized protein LOC103984909 isoform X1 [Musa acuminata subsp. malaccensis] Length = 111 Score = 60.5 bits (145), Expect = 7e-09 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 473 QKEVKSLDEDAWKFAGPRSQVHRISRPG 390 QKEVKSLD+DAWKFAGPRSQ+HRISRPG Sbjct: 59 QKEVKSLDDDAWKFAGPRSQIHRISRPG 86 >ref|XP_018682002.1| PREDICTED: uncharacterized protein LOC103984909 isoform X2 [Musa acuminata subsp. malaccensis] Length = 86 Score = 58.2 bits (139), Expect = 3e-08 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -1 Query: 473 QKEVKSLDEDAWKFAGPRSQVHRISRP 393 QKEVKSLD+DAWKFAGPRSQ+HRISRP Sbjct: 59 QKEVKSLDDDAWKFAGPRSQIHRISRP 85 >gb|PIA58649.1| hypothetical protein AQUCO_00500534v1 [Aquilegia coerulea] Length = 118 Score = 57.8 bits (138), Expect = 8e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 473 QKEVKSLDEDAWKFAGPRSQVHRISRPG 390 QKEVKSLDED+WKFAGPRSQ+H ISRPG Sbjct: 81 QKEVKSLDEDSWKFAGPRSQIHLISRPG 108 >gb|OVA02882.1| hypothetical protein BVC80_9095g77 [Macleaya cordata] Length = 112 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 470 KEVKSLDEDAWKFAGPRSQVHRISRPG 390 KEVKSLDED WKFAGPRSQ+HRISRPG Sbjct: 76 KEVKSLDEDNWKFAGPRSQIHRISRPG 102 >gb|PIA58648.1| hypothetical protein AQUCO_00500534v1 [Aquilegia coerulea] Length = 143 Score = 57.8 bits (138), Expect = 1e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 473 QKEVKSLDEDAWKFAGPRSQVHRISRPG 390 QKEVKSLDED+WKFAGPRSQ+H ISRPG Sbjct: 81 QKEVKSLDEDSWKFAGPRSQIHLISRPG 108 >ref|XP_008776694.1| PREDICTED: uncharacterized protein LOC103696758 [Phoenix dactylifera] Length = 113 Score = 56.6 bits (135), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 473 QKEVKSLDEDAWKFAGPRSQVHRISRPGMH 384 QKEVKSLDED+WKFA PRSQ+H ISRPG H Sbjct: 63 QKEVKSLDEDSWKFARPRSQIHLISRPGGH 92 >ref|XP_020528930.1| uncharacterized protein LOC18443805 isoform X2 [Amborella trichopoda] Length = 102 Score = 54.7 bits (130), Expect = 9e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -1 Query: 473 QKEVKSLDEDAWKFAGPRSQVHRISRPG 390 QKEVKSLDED+WKFAGPRSQ+H ISR G Sbjct: 66 QKEVKSLDEDSWKFAGPRSQIHLISRAG 93 >ref|XP_020597953.1| uncharacterized protein LOC110037604 [Phalaenopsis equestris] Length = 111 Score = 53.9 bits (128), Expect = 2e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 473 QKEVKSLDEDAWKFAGPRSQVHRISRPGMH 384 QKEVKSLDED W F+GPRSQ+H + RPG H Sbjct: 63 QKEVKSLDEDGWMFSGPRSQIHLVLRPGSH 92 >ref|XP_010933437.2| PREDICTED: uncharacterized protein LOC105053831 [Elaeis guineensis] ref|XP_010933438.2| PREDICTED: uncharacterized protein LOC105053831 [Elaeis guineensis] Length = 157 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -1 Query: 473 QKEVKSLDEDAWKFAGPRSQVHRISRPG 390 QKEVKSLDED+WKFA PRSQ+H ISRPG Sbjct: 107 QKEVKSLDEDSWKFARPRSQIHLISRPG 134 >ref|XP_006854049.1| uncharacterized protein LOC18443805 isoform X1 [Amborella trichopoda] gb|ERN15516.1| hypothetical protein AMTR_s00048p00076900 [Amborella trichopoda] Length = 108 Score = 52.8 bits (125), Expect = 5e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 473 QKEVKSLDEDAWKFAGPRSQVHRISR 396 QKEVKSLDED+WKFAGPRSQ+H ISR Sbjct: 66 QKEVKSLDEDSWKFAGPRSQIHLISR 91 >gb|PHT36574.1| hypothetical protein CQW23_24274 [Capsicum baccatum] Length = 102 Score = 52.4 bits (124), Expect = 6e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -1 Query: 470 KEVKSLDEDAWKFAGPRSQVHRISRPG 390 KEVKSLDED+W F GPRS++HRISRPG Sbjct: 50 KEVKSLDEDSWMFDGPRSRIHRISRPG 76 >gb|PHT58589.1| hypothetical protein CQW23_00952 [Capsicum baccatum] gb|PHU28795.1| hypothetical protein BC332_00888 [Capsicum chinense] Length = 113 Score = 52.4 bits (124), Expect = 8e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -1 Query: 470 KEVKSLDEDAWKFAGPRSQVHRISRPG 390 KEVKSLDED+W F GPRS++HRISRPG Sbjct: 67 KEVKSLDEDSWMFDGPRSRIHRISRPG 93 >ref|XP_019445281.1| PREDICTED: uncharacterized protein LOC109349079 isoform X1 [Lupinus angustifolius] Length = 113 Score = 52.4 bits (124), Expect = 8e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 470 KEVKSLDEDAWKFAGPRSQVHRISRPGMHY 381 KEVKSLDED WKF GPRS++H +SRPG Y Sbjct: 67 KEVKSLDEDNWKFEGPRSRIHLVSRPGCGY 96 >ref|XP_015085488.1| PREDICTED: uncharacterized protein LOC107028801 [Solanum pennellii] Length = 113 Score = 52.4 bits (124), Expect = 8e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -1 Query: 470 KEVKSLDEDAWKFAGPRSQVHRISRPG 390 KEVKSLDED+W F GPRS++HRISRPG Sbjct: 67 KEVKSLDEDSWMFDGPRSRIHRISRPG 93 >ref|XP_004245995.1| PREDICTED: uncharacterized protein LOC101246949 [Solanum lycopersicum] Length = 113 Score = 52.4 bits (124), Expect = 8e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -1 Query: 470 KEVKSLDEDAWKFAGPRSQVHRISRPG 390 KEVKSLDED+W F GPRS++HRISRPG Sbjct: 67 KEVKSLDEDSWMFDGPRSRIHRISRPG 93