BLASTX nr result
ID: Cheilocostus21_contig00023551
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00023551 (575 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009404052.1| PREDICTED: intron-binding protein aquarius [... 67 2e-09 >ref|XP_009404052.1| PREDICTED: intron-binding protein aquarius [Musa acuminata subsp. malaccensis] Length = 1505 Score = 67.0 bits (162), Expect = 2e-09 Identities = 34/49 (69%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Frame = +1 Query: 82 AYQELPPNANGLEDSAPENPSEDTDMPSANGDADNGTFE-NTIVEDAME 225 A+QE P+ANG +DS EN SEDTDMP+ANGDADN TFE NT ED ME Sbjct: 1457 AHQESVPSANGAQDSTSENQSEDTDMPTANGDADNETFEDNTTGEDQME 1505