BLASTX nr result
ID: Cheilocostus21_contig00023168
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00023168 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009413503.1| PREDICTED: uncharacterized protein LOC103994... 58 4e-07 >ref|XP_009413503.1| PREDICTED: uncharacterized protein LOC103994789 [Musa acuminata subsp. malaccensis] Length = 264 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 103 PPASPPNPITMAQDRMKELEIGFRNWLAKQSM 198 PPASPPNP+ +AQ R+KELE GFR WLAKQSM Sbjct: 18 PPASPPNPVALAQARIKELETGFRAWLAKQSM 49