BLASTX nr result
ID: Cheilocostus21_contig00022850
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00022850 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009384364.1| PREDICTED: uncharacterized protein LOC103971... 55 5e-06 >ref|XP_009384364.1| PREDICTED: uncharacterized protein LOC103971929 [Musa acuminata subsp. malaccensis] Length = 548 Score = 55.5 bits (132), Expect = 5e-06 Identities = 33/54 (61%), Positives = 35/54 (64%), Gaps = 2/54 (3%) Frame = -3 Query: 217 MNRLQRLISVXXXXXXXP--TVMEKERKNSSFHRIFPLLLLTLYAVGSVLRLAL 62 MNR QR S V+EKERK+ HR FPLLLLTLYAVGSVLRLAL Sbjct: 1 MNRQQRNASALPTPAQVSHLVVVEKERKSGFLHRAFPLLLLTLYAVGSVLRLAL 54