BLASTX nr result
ID: Cheilocostus21_contig00022725
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00022725 (515 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009394446.2| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 59 3e-07 ref|XP_010923597.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 59 4e-07 gb|KQL06539.1| hypothetical protein SETIT_003200mg [Setaria ital... 56 7e-07 ref|XP_008791238.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 58 8e-07 gb|PIA39665.1| hypothetical protein AQUCO_02600247v1 [Aquilegia ... 58 8e-07 gb|PIA39664.1| hypothetical protein AQUCO_02600247v1, partial [A... 58 9e-07 ref|XP_020106298.1| peptidyl-tRNA hydrolase, mitochondrial-like ... 57 1e-06 ref|XP_010519200.1| PREDICTED: peptidyl-tRNA hydrolase, chloropl... 57 2e-06 ref|XP_010519199.1| PREDICTED: peptidyl-tRNA hydrolase, chloropl... 57 2e-06 ref|XP_010519198.1| PREDICTED: peptidyl-tRNA hydrolase, chloropl... 57 2e-06 gb|ONK81766.1| uncharacterized protein A4U43_C01F32660 [Asparagu... 56 2e-06 ref|XP_004969630.1| peptidyl-tRNA hydrolase, mitochondrial [Seta... 56 3e-06 ref|XP_002511963.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 56 3e-06 gb|PKA55558.1| Peptidyl-tRNA hydrolase, mitochondrial [Apostasia... 56 4e-06 ref|XP_020265755.1| peptidyl-tRNA hydrolase, mitochondrial-like ... 56 4e-06 ref|XP_003569608.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 55 5e-06 gb|EEC71320.1| hypothetical protein OsI_03361 [Oryza sativa Indi... 55 5e-06 ref|XP_015626738.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 55 5e-06 ref|XP_021803776.1| peptidyl-tRNA hydrolase, chloroplastic-like ... 52 5e-06 ref|XP_017617163.1| PREDICTED: peptidyl-tRNA hydrolase, chloropl... 55 6e-06 >ref|XP_009394446.2| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial [Musa acuminata subsp. malaccensis] Length = 280 Score = 59.3 bits (142), Expect = 3e-07 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNS--VQVLNS 117 EREELD+AFQRGLE +R L+LEG NKSATFVN+ Q+LNS Sbjct: 240 EREELDFAFQRGLEAIRILLLEGLNKSATFVNTSQSQLLNS 280 >ref|XP_010923597.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial [Elaeis guineensis] Length = 257 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNSVQ 105 EREE+D+ FQRG+E +R L+LEG NKSATFVNSVQ Sbjct: 216 EREEIDFTFQRGIEAIRILVLEGINKSATFVNSVQ 250 >gb|KQL06539.1| hypothetical protein SETIT_003200mg [Setaria italica] Length = 140 Score = 56.2 bits (134), Expect = 7e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNSVQ 105 E+EELD+AF RGLE VR ++LEGFNKSAT+VN+ Q Sbjct: 99 EQEELDFAFHRGLEAVRIMVLEGFNKSATYVNTTQ 133 >ref|XP_008791238.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial [Phoenix dactylifera] Length = 257 Score = 57.8 bits (138), Expect = 8e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNSVQ 105 EREELD+ FQRG+E VR L+LEG NKSATFVNS Q Sbjct: 216 EREELDFTFQRGVEAVRILVLEGINKSATFVNSAQ 250 >gb|PIA39665.1| hypothetical protein AQUCO_02600247v1 [Aquilegia coerulea] Length = 262 Score = 57.8 bits (138), Expect = 8e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNSVQVL 111 ER+ELD+ FQ G+E +RTL+LEGFNKSATFVNS + L Sbjct: 222 ERQELDFTFQDGVEAIRTLLLEGFNKSATFVNSKKTL 258 >gb|PIA39664.1| hypothetical protein AQUCO_02600247v1, partial [Aquilegia coerulea] Length = 276 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNSVQVL 111 ER+ELD+ FQ G+E +RTL+LEGFNKSATFVNS + L Sbjct: 236 ERQELDFTFQDGVEAIRTLLLEGFNKSATFVNSKKTL 272 >ref|XP_020106298.1| peptidyl-tRNA hydrolase, mitochondrial-like [Ananas comosus] Length = 258 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNSVQ 105 EREELD+ F RGL+ VR L+LEGFNKSATFVNS Q Sbjct: 217 EREELDFTFHRGLQAVRILVLEGFNKSATFVNSSQ 251 >ref|XP_010519200.1| PREDICTED: peptidyl-tRNA hydrolase, chloroplastic isoform X3 [Tarenaya hassleriana] Length = 263 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNS 99 EREELD+ FQ GLE +R L+LEGFNKSATFVNS Sbjct: 223 EREELDFTFQTGLEAIRILLLEGFNKSATFVNS 255 >ref|XP_010519199.1| PREDICTED: peptidyl-tRNA hydrolase, chloroplastic isoform X2 [Tarenaya hassleriana] Length = 283 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNS 99 EREELD+ FQ GLE +R L+LEGFNKSATFVNS Sbjct: 243 EREELDFTFQTGLEAIRILLLEGFNKSATFVNS 275 >ref|XP_010519198.1| PREDICTED: peptidyl-tRNA hydrolase, chloroplastic isoform X1 [Tarenaya hassleriana] Length = 291 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNS 99 EREELD+ FQ GLE +R L+LEGFNKSATFVNS Sbjct: 251 EREELDFTFQTGLEAIRILLLEGFNKSATFVNS 283 >gb|ONK81766.1| uncharacterized protein A4U43_C01F32660 [Asparagus officinalis] Length = 181 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNSVQ 105 E+EELD+ FQRGL+ +R L+LEGFNKSATF NS Q Sbjct: 141 EQEELDFTFQRGLDALRILVLEGFNKSATFTNSAQ 175 >ref|XP_004969630.1| peptidyl-tRNA hydrolase, mitochondrial [Setaria italica] Length = 247 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNSVQ 105 E+EELD+AF RGLE VR ++LEGFNKSAT+VN+ Q Sbjct: 206 EQEELDFAFHRGLEAVRIMVLEGFNKSATYVNTTQ 240 >ref|XP_002511963.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial [Ricinus communis] gb|EEF50632.1| peptidyl-tRNA hydrolase, putative [Ricinus communis] Length = 272 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNSVQ 105 E EELD+ FQ+GLE +R L+LEGFNKSATFVNS + Sbjct: 232 EHEELDFTFQQGLEAIRILLLEGFNKSATFVNSAK 266 >gb|PKA55558.1| Peptidyl-tRNA hydrolase, mitochondrial [Apostasia shenzhenica] Length = 252 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNSVQ 105 EREE+D+ FQRG+E +R L+LEG NKSATFVN+ Q Sbjct: 212 EREEMDFTFQRGVEAIRILLLEGLNKSATFVNTAQ 246 >ref|XP_020265755.1| peptidyl-tRNA hydrolase, mitochondrial-like [Asparagus officinalis] Length = 279 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNSVQ 105 E+EELD+ FQRGL+ +R L+LEGFNKSATF NS Q Sbjct: 239 EQEELDFTFQRGLDALRILVLEGFNKSATFTNSAQ 273 >ref|XP_003569608.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial [Brachypodium distachyon] gb|KQK09296.1| hypothetical protein BRADI_2g47250v3 [Brachypodium distachyon] Length = 249 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNSVQ 105 E+EELD+ F RGLE VR + +EGFNKSATFVN+VQ Sbjct: 208 EQEELDFTFHRGLEAVRIMTVEGFNKSATFVNTVQ 242 >gb|EEC71320.1| hypothetical protein OsI_03361 [Oryza sativa Indica Group] Length = 250 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNSVQ 105 E+EELD+AF RGLE VR + LEGFNKSAT+VN+ Q Sbjct: 209 EQEELDFAFHRGLEAVRIMALEGFNKSATYVNTAQ 243 >ref|XP_015626738.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial [Oryza sativa Japonica Group] sp|Q5N9Q7.1|PTHM_ORYSJ RecName: Full=Peptidyl-tRNA hydrolase, mitochondrial; AltName: Full=M-PTH; Flags: Precursor dbj|BAD81799.1| Peptidyl-tRNA hydrolase-like [Oryza sativa Japonica Group] dbj|BAF05862.1| Os01g0693900 [Oryza sativa Japonica Group] dbj|BAG94340.1| unnamed protein product [Oryza sativa Japonica Group] gb|EEE55225.1| hypothetical protein OsJ_03102 [Oryza sativa Japonica Group] dbj|BAS73831.1| Os01g0693900 [Oryza sativa Japonica Group] Length = 250 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNSVQ 105 E+EELD+AF RGLE VR + LEGFNKSAT+VN+ Q Sbjct: 209 EQEELDFAFHRGLEAVRIMALEGFNKSATYVNTAQ 243 >ref|XP_021803776.1| peptidyl-tRNA hydrolase, chloroplastic-like [Prunus avium] Length = 82 Score = 52.4 bits (124), Expect = 5e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNSVQVL 111 E EEL++ FQ G+E VR L+LEGFNKSATFVNS + L Sbjct: 42 ELEELNFTFQDGVEAVRILLLEGFNKSATFVNSAKPL 78 >ref|XP_017617163.1| PREDICTED: peptidyl-tRNA hydrolase, chloroplastic-like [Gossypium arboreum] ref|XP_017617164.1| PREDICTED: peptidyl-tRNA hydrolase, chloroplastic-like [Gossypium arboreum] Length = 262 Score = 55.5 bits (132), Expect = 6e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +1 Query: 1 EREELDYAFQRGLEGVRTLMLEGFNKSATFVNSVQVL 111 E EEL++ F+RG+E VR L+LEGFNKSATFVNS + + Sbjct: 222 EHEELEFTFERGIEAVRILLLEGFNKSATFVNSTKAM 258