BLASTX nr result
ID: Cheilocostus21_contig00022704
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00022704 (512 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009403938.1| PREDICTED: heat shock 70 kDa protein 17-like... 56 5e-06 ref|XP_009380335.1| PREDICTED: heat shock 70 kDa protein 17-like... 56 7e-06 >ref|XP_009403938.1| PREDICTED: heat shock 70 kDa protein 17-like [Musa acuminata subsp. malaccensis] Length = 893 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +2 Query: 5 EELQKKTSVFVTPIFTSEEIYEKATKLQDKVAALNR 112 EELQKK S+ TPIFTS+E+Y+K +KLQDKVA++NR Sbjct: 799 EELQKKASLLSTPIFTSDEVYQKVSKLQDKVASVNR 834 >ref|XP_009380335.1| PREDICTED: heat shock 70 kDa protein 17-like [Musa acuminata subsp. malaccensis] Length = 896 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +2 Query: 2 KEELQKKTSVFVTPIFTSEEIYEKATKLQDKVAALNR 112 KEE QK+TS+ TPIF SEE+Y+K KLQDKVA++NR Sbjct: 798 KEEQQKRTSILSTPIFESEEVYQKVAKLQDKVASVNR 834