BLASTX nr result
ID: Cheilocostus21_contig00022670
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00022670 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABI95858.1| 1-aminocyclopropane-1-carboxylate oxidase [Nicoti... 75 2e-13 ref|NP_001312327.1| 1-aminocyclopropane-1-carboxylate oxidase [N... 74 4e-13 emb|CAA58232.1| 1-amniocyclopropane-1-carboxylate oxidase [Nicot... 74 4e-13 dbj|BAR72291.1| Aminocyclopropanecarboxylate oxidase [Nicotiana ... 74 5e-13 ref|XP_009802116.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 74 5e-13 gb|POE69785.1| 1-aminocyclopropane-1-carboxylate oxidase [Quercu... 69 7e-13 gb|PON91314.1| Oxoglutarate/iron-dependent dioxygenase [Trema or... 74 7e-13 gb|PON52166.1| Oxoglutarate/iron-dependent dioxygenase [Paraspon... 74 7e-13 gb|AFZ76981.1| ACC oxidase [Boehmeria nivea] 74 1e-12 ref|WP_104112180.1| hypothetical protein [Arthrobacter sp. N199823] 69 1e-12 ref|XP_019249854.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 73 2e-12 ref|NP_001312109.1| 1-aminocyclopropane-1-carboxylate oxidase-li... 72 2e-12 ref|XP_009609240.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 72 2e-12 gb|AAA99793.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Ni... 72 2e-12 gb|POF08832.1| 1-aminocyclopropane-1-carboxylate oxidase [Quercu... 72 3e-12 emb|CDP04457.1| unnamed protein product [Coffea canephora] 72 3e-12 gb|AGM48542.1| 1-aminocyclopropane-1-carboxylate oxidase [Coffea... 72 3e-12 gb|PNT38899.1| hypothetical protein POPTR_004G003000v3 [Populus ... 72 3e-12 ref|XP_006383841.1| aminocyclopropane carboxylate oxidase family... 72 5e-12 gb|ABK96379.1| unknown [Populus trichocarpa x Populus deltoides] 72 5e-12 >gb|ABI95858.1| 1-aminocyclopropane-1-carboxylate oxidase [Nicotiana suaveolens] Length = 308 Score = 75.5 bits (184), Expect = 2e-13 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = -3 Query: 326 VLYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 V+YPKF+FEDYMKLY KF+AKEPRFEAMKA+E+TVNA P+A+ Sbjct: 264 VIYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAVENTVNAAPIAT 307 >ref|NP_001312327.1| 1-aminocyclopropane-1-carboxylate oxidase [Nicotiana tabacum] gb|ADR73045.1| ACC oxidase 2 isoform A [Nicotiana tabacum] Length = 308 Score = 74.3 bits (181), Expect = 4e-13 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = -3 Query: 326 VLYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 V+YPKF+FEDYMKLY KF+AKEPRFEAMKA+E+TVN+ P+A+ Sbjct: 264 VIYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAVETTVNSAPIAT 307 >emb|CAA58232.1| 1-amniocyclopropane-1-carboxylate oxidase [Nicotiana tabacum] Length = 308 Score = 74.3 bits (181), Expect = 4e-13 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = -3 Query: 326 VLYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 V+YPKF+FEDYMKLY KF+AKEPRFEAMKA+E+TVN+ P+A+ Sbjct: 264 VIYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAVETTVNSAPIAT 307 >dbj|BAR72291.1| Aminocyclopropanecarboxylate oxidase [Nicotiana benthamiana] Length = 316 Score = 74.3 bits (181), Expect = 5e-13 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = -3 Query: 326 VLYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 V+YPKF+FEDYMKLY KF+AKEPRFEAMKA+E+TVN+ P+A+ Sbjct: 272 VIYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAVETTVNSAPIAT 315 >ref|XP_009802116.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Nicotiana sylvestris] Length = 316 Score = 74.3 bits (181), Expect = 5e-13 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = -3 Query: 326 VLYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 V+YPKF+FEDYMKLY KF+AKEPRFEAMKA+E+TVN+ P+A+ Sbjct: 272 VIYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAVETTVNSAPIAT 315 >gb|POE69785.1| 1-aminocyclopropane-1-carboxylate oxidase [Quercus suber] Length = 86 Score = 69.3 bits (168), Expect = 7e-13 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -3 Query: 329 GVLYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPV 201 G YPKF+FEDYMKLY KF+AKEPRFEAMKA+EST+N P+ Sbjct: 41 GQAYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAMESTINLGPI 83 >gb|PON91314.1| Oxoglutarate/iron-dependent dioxygenase [Trema orientalis] Length = 326 Score = 73.9 bits (180), Expect = 7e-13 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = -3 Query: 344 DKPTAGVLYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 D+ VLYPKF+FEDYMKLY KF+AKEPRFEAMKA+ES VN P+A+ Sbjct: 276 DEKNQAVLYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAMESAVNVGPIAT 325 >gb|PON52166.1| Oxoglutarate/iron-dependent dioxygenase [Parasponia andersonii] Length = 326 Score = 73.9 bits (180), Expect = 7e-13 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = -3 Query: 344 DKPTAGVLYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 D+ VLYPKF+FEDYMKLY KF+AKEPRFEAMKA+ES VN P+A+ Sbjct: 276 DEKNQAVLYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAMESAVNVGPIAT 325 >gb|AFZ76981.1| ACC oxidase [Boehmeria nivea] Length = 326 Score = 73.6 bits (179), Expect = 1e-12 Identities = 33/50 (66%), Positives = 42/50 (84%) Frame = -3 Query: 344 DKPTAGVLYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 D+ + V+YPKF+F+DYMKLY KF+AKEPRFEAMKA+ES VNA P+A+ Sbjct: 276 DEKKSSVVYPKFVFDDYMKLYAGLKFQAKEPRFEAMKAMESAVNADPIAT 325 >ref|WP_104112180.1| hypothetical protein [Arthrobacter sp. N199823] Length = 110 Score = 69.3 bits (168), Expect = 1e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = -3 Query: 344 DKPTAGVLYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 +K T+ V YPKF+FEDYMKLY KF+AKEPRFEAMKA+E TVN P+A+ Sbjct: 61 EKETSEV-YPKFVFEDYMKLYAGLKFQAKEPRFEAMKAMEPTVNLGPIAT 109 >ref|XP_019249854.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Nicotiana attenuata] gb|ABO32691.1| ACC oxidase ACO3 [Nicotiana attenuata] gb|OIT00518.1| 1-aminocyclopropane-1-carboxylate oxidase 4 [Nicotiana attenuata] Length = 316 Score = 72.8 bits (177), Expect = 2e-12 Identities = 31/43 (72%), Positives = 39/43 (90%) Frame = -3 Query: 323 LYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 +YPKF+FEDYMKLY KF+AKEPRFEAMKA+E+TVN+ P+A+ Sbjct: 273 IYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAVETTVNSAPIAT 315 >ref|NP_001312109.1| 1-aminocyclopropane-1-carboxylate oxidase-like [Nicotiana tabacum] gb|ADR73046.1| ACC oxidase 2 isoform B [Nicotiana tabacum] Length = 308 Score = 72.4 bits (176), Expect = 2e-12 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -3 Query: 326 VLYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 V+YPKF+FEDYMKLY KF+AKEPRFEAMKA+E+ VN+ P+A+ Sbjct: 264 VIYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAVETAVNSAPIAT 307 >ref|XP_009609240.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Nicotiana tomentosiformis] Length = 316 Score = 72.4 bits (176), Expect = 2e-12 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -3 Query: 326 VLYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 V+YPKF+FEDYMKLY KF+AKEPRFEAMKA+E+ VN+ P+A+ Sbjct: 272 VIYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAVETAVNSAPIAT 315 >gb|AAA99793.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Nicotiana glutinosa] Length = 316 Score = 72.4 bits (176), Expect = 2e-12 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -3 Query: 326 VLYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 V+YPKF+FEDYMKLY KF+AKEPRFEAMKA+E+ VN+ P+A+ Sbjct: 272 VIYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAVETAVNSAPIAT 315 >gb|POF08832.1| 1-aminocyclopropane-1-carboxylate oxidase [Quercus suber] Length = 279 Score = 71.6 bits (174), Expect = 3e-12 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -3 Query: 323 LYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 LYPKF+FEDYMKLY KF+AKEPRFEAMKAIES VN P+A+ Sbjct: 236 LYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAIESNVNVGPIAT 278 >emb|CDP04457.1| unnamed protein product [Coffea canephora] Length = 318 Score = 72.0 bits (175), Expect = 3e-12 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -3 Query: 323 LYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 +YPKF+FEDYMKLY KF+AKEPRFEAMKA+ESTVN P+A+ Sbjct: 275 IYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAVESTVNLGPIAT 317 >gb|AGM48542.1| 1-aminocyclopropane-1-carboxylate oxidase [Coffea arabica] Length = 318 Score = 72.0 bits (175), Expect = 3e-12 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -3 Query: 323 LYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 +YPKF+FEDYMKLY KF+AKEPRFEAMKA+ESTVN P+A+ Sbjct: 275 IYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAVESTVNLGPIAT 317 >gb|PNT38899.1| hypothetical protein POPTR_004G003000v3 [Populus trichocarpa] Length = 285 Score = 71.6 bits (174), Expect = 3e-12 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = -3 Query: 323 LYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 +YPKF+FEDYMKLY KF+AKEPRFEAMKA+EST+N P+A+ Sbjct: 242 IYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAVESTINMGPIAT 284 >ref|XP_006383841.1| aminocyclopropane carboxylate oxidase family protein [Populus trichocarpa] gb|PNT38900.1| hypothetical protein POPTR_004G003000v3 [Populus trichocarpa] Length = 318 Score = 71.6 bits (174), Expect = 5e-12 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = -3 Query: 323 LYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 +YPKF+FEDYMKLY KF+AKEPRFEAMKA+EST+N P+A+ Sbjct: 275 IYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAVESTINMGPIAT 317 >gb|ABK96379.1| unknown [Populus trichocarpa x Populus deltoides] Length = 318 Score = 71.6 bits (174), Expect = 5e-12 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = -3 Query: 323 LYPKFLFEDYMKLYVKQKFEAKEPRFEAMKAIESTVNAVPVAS 195 +YPKF+FEDYMKLY KF+AKEPRFEAMKA+EST+N P+A+ Sbjct: 275 IYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAVESTINMGPIAT 317