BLASTX nr result
ID: Cheilocostus21_contig00022536
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00022536 (670 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020276468.1| light-inducible protein CPRF2-like [Asparagu... 59 3e-08 gb|KDO48917.1| hypothetical protein CISIN_1g0122872mg, partial [... 60 1e-07 gb|PHT74904.1| Light-inducible protein CPRF2 [Capsicum annuum] 61 3e-07 ref|NP_001236299.1| G/HBF-1 protein [Glycine max] >gi|1905785|em... 61 3e-07 ref|NP_001312947.1| light-inducible protein CPRF2-like [Nicotian... 61 3e-07 ref|XP_020267765.1| light-inducible protein CPRF2-like isoform X... 59 7e-07 ref|XP_020267764.1| light-inducible protein CPRF2-like isoform X... 59 7e-07 gb|KDO48916.1| hypothetical protein CISIN_1g0122872mg, partial [... 59 9e-07 ref|XP_018826989.1| PREDICTED: light-inducible protein CPRF2 [Ju... 59 1e-06 dbj|GAY44621.1| hypothetical protein CUMW_083310 [Citrus unshiu] 59 1e-06 gb|AAL77201.1| bZIP protein, partial [Oryza sativa] 58 1e-06 ref|XP_020519877.1| light-inducible protein CPRF2 isoform X3 [Am... 59 2e-06 ref|XP_011091948.1| light-inducible protein CPRF2 [Sesamum indicum] 59 2e-06 ref|XP_006471677.1| PREDICTED: light-inducible protein CPRF2 [Ci... 59 2e-06 gb|AGD98704.1| bZIP transcription factor family protein 6 [Camel... 59 2e-06 dbj|GAV75773.1| bZIP_1 domain-containing protein/bZIP_C domain-c... 59 2e-06 ref|XP_009610430.1| PREDICTED: light-inducible protein CPRF2 [Ni... 59 2e-06 ref|XP_009787496.1| PREDICTED: light-inducible protein CPRF2-lik... 59 2e-06 ref|XP_010274217.1| PREDICTED: light-inducible protein CPRF2 iso... 59 2e-06 ref|XP_010274216.1| PREDICTED: light-inducible protein CPRF2 iso... 59 2e-06 >ref|XP_020276468.1| light-inducible protein CPRF2-like [Asparagus officinalis] Length = 82 Score = 59.3 bits (142), Expect = 3e-08 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQVS 132 VSQLRVENS LLKRL+ + QKYNEA N LKADVE LR +VS Sbjct: 35 VSQLRVENSALLKRLTDINQKYNEASVDNRILKADVETLRAKVS 78 >gb|KDO48917.1| hypothetical protein CISIN_1g0122872mg, partial [Citrus sinensis] Length = 145 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQVSYLQLA 147 VSQLRVENS LLKRL+ ++QKYNEA N LKADVE LR +V + ++ Sbjct: 96 VSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKVMHSSIS 144 >gb|PHT74904.1| Light-inducible protein CPRF2 [Capsicum annuum] Length = 350 Score = 60.8 bits (146), Expect = 3e-07 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQVSYLQL 144 VSQLRVENS LLKRL+ ++QKYNE+ N LKADVE LR + S L+L Sbjct: 171 VSQLRVENSSLLKRLTDISQKYNESAVDNRVLKADVETLRAKASLLKL 218 >ref|NP_001236299.1| G/HBF-1 protein [Glycine max] emb|CAA71687.1| G/HBF-1 [Glycine max] Length = 378 Score = 60.8 bits (146), Expect = 3e-07 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQV 129 VSQLRVENS LLKRL+ ++QKYNEA N LKADVE LRT+V Sbjct: 205 VSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRTKV 247 >ref|NP_001312947.1| light-inducible protein CPRF2-like [Nicotiana tabacum] gb|AAL27150.1| bZIP transcription factor [Nicotiana tabacum] Length = 450 Score = 60.8 bits (146), Expect = 3e-07 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQV 129 VSQLRVENS LLKRL+ ++QKYNEA N LKADVE LRT+V Sbjct: 277 VSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRTKV 319 >ref|XP_020267765.1| light-inducible protein CPRF2-like isoform X2 [Asparagus officinalis] Length = 266 Score = 59.3 bits (142), Expect = 7e-07 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQVS 132 VSQLRVENS LLKRL+ + QKYNEA N LKADVE LR +VS Sbjct: 219 VSQLRVENSALLKRLTDINQKYNEASVDNRILKADVETLRAKVS 262 >ref|XP_020267764.1| light-inducible protein CPRF2-like isoform X1 [Asparagus officinalis] Length = 276 Score = 59.3 bits (142), Expect = 7e-07 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQVS 132 VSQLRVENS LLKRL+ + QKYNEA N LKADVE LR +VS Sbjct: 229 VSQLRVENSALLKRLTDINQKYNEASVDNRILKADVETLRAKVS 272 >gb|KDO48916.1| hypothetical protein CISIN_1g0122872mg, partial [Citrus sinensis] Length = 270 Score = 58.9 bits (141), Expect = 9e-07 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQV 129 VSQLRVENS LLKRL+ ++QKYNEA N LKADVE LR +V Sbjct: 96 VSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKV 138 >ref|XP_018826989.1| PREDICTED: light-inducible protein CPRF2 [Juglans regia] Length = 468 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQV 129 V+QLRVENS LLKRL+ +TQKYNEA N LKADVE LR +V Sbjct: 296 VAQLRVENSSLLKRLTEITQKYNEAAVDNRVLKADVETLRAKV 338 >dbj|GAY44621.1| hypothetical protein CUMW_083310 [Citrus unshiu] Length = 346 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQV 129 VSQLRVENS LLKRL+ ++QKYNEA N LKADVE LR +V Sbjct: 172 VSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKV 214 >gb|AAL77201.1| bZIP protein, partial [Oryza sativa] Length = 240 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQV 129 VSQLRVENS LL+RL+ + QKYN+A N LKADVE LRT+V Sbjct: 79 VSQLRVENSSLLRRLADVNQKYNDAAVDNRVLKADVETLRTKV 121 >ref|XP_020519877.1| light-inducible protein CPRF2 isoform X3 [Amborella trichopoda] Length = 297 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQV 129 V+QLRVENS LLKRLS ++QKYNEA N LKADVE LR +V Sbjct: 244 VAQLRVENSSLLKRLSDISQKYNEAAVDNRILKADVETLRAKV 286 >ref|XP_011091948.1| light-inducible protein CPRF2 [Sesamum indicum] Length = 423 Score = 58.9 bits (141), Expect = 2e-06 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQV 129 VSQLRVENS LLKRL+ ++QKYNEA N LKADVE LR +V Sbjct: 256 VSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKV 298 >ref|XP_006471677.1| PREDICTED: light-inducible protein CPRF2 [Citrus sinensis] Length = 432 Score = 58.9 bits (141), Expect = 2e-06 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQV 129 VSQLRVENS LLKRL+ ++QKYNEA N LKADVE LR +V Sbjct: 258 VSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKV 300 >gb|AGD98704.1| bZIP transcription factor family protein 6 [Camellia sinensis] Length = 444 Score = 58.9 bits (141), Expect = 2e-06 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQV 129 VSQLRVENS LLKRLS ++QKYNE+ N LKADVE LR +V Sbjct: 279 VSQLRVENSSLLKRLSDISQKYNESAVDNRVLKADVETLRAKV 321 >dbj|GAV75773.1| bZIP_1 domain-containing protein/bZIP_C domain-containing protein [Cephalotus follicularis] Length = 446 Score = 58.9 bits (141), Expect = 2e-06 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQV 129 VSQLRVENS LLKRL+ ++QKYNEA N LKADVE LR +V Sbjct: 273 VSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKV 315 >ref|XP_009610430.1| PREDICTED: light-inducible protein CPRF2 [Nicotiana tomentosiformis] Length = 449 Score = 58.9 bits (141), Expect = 2e-06 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQV 129 VSQLRVENS LLKRL+ ++QKYNEA N LKADVE LR +V Sbjct: 276 VSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKV 318 >ref|XP_009787496.1| PREDICTED: light-inducible protein CPRF2-like [Nicotiana sylvestris] ref|XP_016450151.1| PREDICTED: light-inducible protein CPRF2-like [Nicotiana tabacum] Length = 450 Score = 58.9 bits (141), Expect = 2e-06 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQV 129 VSQLRVENS LLKRL+ ++QKYNEA N LKADVE LR +V Sbjct: 277 VSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKV 319 >ref|XP_010274217.1| PREDICTED: light-inducible protein CPRF2 isoform X2 [Nelumbo nucifera] Length = 455 Score = 58.9 bits (141), Expect = 2e-06 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQV 129 VSQLRVENS LLKRL+ ++QKYNEA N LKADVE LR +V Sbjct: 265 VSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKV 307 >ref|XP_010274216.1| PREDICTED: light-inducible protein CPRF2 isoform X1 [Nelumbo nucifera] Length = 457 Score = 58.9 bits (141), Expect = 2e-06 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 1 VSQLRVENSLLLKRLSSMTQKYNEAVAHNTTLKADVEILRTQV 129 VSQLRVENS LLKRL+ ++QKYNEA N LKADVE LR +V Sbjct: 267 VSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKV 309