BLASTX nr result
ID: Cheilocostus21_contig00022496
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00022496 (927 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012858708.1| PREDICTED: nascent polypeptide-associated co... 65 1e-08 gb|KZM92256.1| hypothetical protein DCAR_020379 [Daucus carota s... 61 3e-08 gb|EPS61304.1| hypothetical protein M569_13494, partial [Genlise... 63 7e-08 ref|XP_006347524.1| PREDICTED: nascent polypeptide-associated co... 62 8e-08 ref|XP_004235032.1| PREDICTED: nascent polypeptide-associated co... 62 8e-08 gb|PHT53543.1| Nascent polypeptide-associated complex subunit al... 62 8e-08 ref|XP_016556427.1| PREDICTED: nascent polypeptide-associated co... 62 8e-08 gb|PPR98578.1| hypothetical protein GOBAR_AA22087 [Gossypium bar... 62 8e-08 ref|XP_019227180.1| PREDICTED: nascent polypeptide-associated co... 62 8e-08 ref|XP_016454742.1| PREDICTED: nascent polypeptide-associated co... 62 8e-08 ref|XP_009769959.1| PREDICTED: nascent polypeptide-associated co... 62 8e-08 ref|XP_009605401.1| PREDICTED: nascent polypeptide-associated co... 62 8e-08 gb|KFK34228.1| hypothetical protein AALP_AA5G117600 [Arabis alpina] 62 8e-08 ref|XP_022891140.1| nascent polypeptide-associated complex subun... 62 9e-08 gb|AAK48972.1|AF370545_1 alpha NAC-like protein [Arabidopsis tha... 62 9e-08 gb|KJB52489.1| hypothetical protein B456_008G264600 [Gossypium r... 62 9e-08 ref|NP_190516.1| nascent polypeptide-associated complex subunit ... 62 9e-08 ref|XP_002875967.1| nascent polypeptide-associated complex subun... 62 9e-08 ref|XP_010503604.1| PREDICTED: nascent polypeptide-associated co... 62 1e-07 ref|XP_012439931.1| PREDICTED: nascent polypeptide-associated co... 62 1e-07 >ref|XP_012858708.1| PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 2 [Erythranthe guttata] gb|EYU19703.1| hypothetical protein MIMGU_mgv1a014035mg [Erythranthe guttata] Length = 203 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNVS 828 RSEKKSRKAMLKLGMKP+TGVSRVSIKRTKNVS Sbjct: 56 RSEKKSRKAMLKLGMKPITGVSRVSIKRTKNVS 88 >gb|KZM92256.1| hypothetical protein DCAR_020379 [Daucus carota subsp. sativus] Length = 89 Score = 60.8 bits (146), Expect = 3e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKN 834 RSEKKSRKAMLKLGMKPVTGVSRV+IKRTKN Sbjct: 57 RSEKKSRKAMLKLGMKPVTGVSRVTIKRTKN 87 >gb|EPS61304.1| hypothetical protein M569_13494, partial [Genlisea aurea] Length = 237 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNVSGSDLLASY 804 RSEKKSRKAMLKLGMKPVTGVSRV++K++KNVS S L+ ++ Sbjct: 74 RSEKKSRKAMLKLGMKPVTGVSRVTVKKSKNVSLSTLIHAH 114 >ref|XP_006347524.1| PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 2 [Solanum tuberosum] Length = 204 Score = 62.4 bits (150), Expect = 8e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNV 831 RSEKKSRKAMLKLGMKPVTGVSRV+IKRTKNV Sbjct: 59 RSEKKSRKAMLKLGMKPVTGVSRVTIKRTKNV 90 >ref|XP_004235032.1| PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 2 [Solanum lycopersicum] ref|XP_015070730.1| PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 2 [Solanum pennellii] Length = 204 Score = 62.4 bits (150), Expect = 8e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNV 831 RSEKKSRKAMLKLGMKPVTGVSRV+IKRTKNV Sbjct: 59 RSEKKSRKAMLKLGMKPVTGVSRVTIKRTKNV 90 >gb|PHT53543.1| Nascent polypeptide-associated complex subunit alpha-like protein 4 [Capsicum baccatum] Length = 205 Score = 62.4 bits (150), Expect = 8e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNV 831 RSEKKSRKAMLKLGMKPVTGVSRV+IKRTKNV Sbjct: 59 RSEKKSRKAMLKLGMKPVTGVSRVTIKRTKNV 90 >ref|XP_016556427.1| PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 2 [Capsicum annuum] gb|PHT87620.1| Nascent polypeptide-associated complex subunit alpha-like protein 4 [Capsicum annuum] gb|PHU23573.1| Nascent polypeptide-associated complex subunit alpha-like protein 4 [Capsicum chinense] Length = 205 Score = 62.4 bits (150), Expect = 8e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNV 831 RSEKKSRKAMLKLGMKPVTGVSRV+IKRTKNV Sbjct: 59 RSEKKSRKAMLKLGMKPVTGVSRVTIKRTKNV 90 >gb|PPR98578.1| hypothetical protein GOBAR_AA22087 [Gossypium barbadense] Length = 207 Score = 62.4 bits (150), Expect = 8e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNV 831 RSEKKSRKAMLKLGMKPVTGVSRV+IKRTKNV Sbjct: 62 RSEKKSRKAMLKLGMKPVTGVSRVTIKRTKNV 93 >ref|XP_019227180.1| PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 2 [Nicotiana attenuata] gb|OIT31575.1| nascent polypeptide-associated complex subunit alpha-like protein 2 [Nicotiana attenuata] Length = 207 Score = 62.4 bits (150), Expect = 8e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNV 831 RSEKKSRKAMLKLGMKPVTGVSRV+IKRTKNV Sbjct: 61 RSEKKSRKAMLKLGMKPVTGVSRVTIKRTKNV 92 >ref|XP_016454742.1| PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 2 [Nicotiana tabacum] Length = 207 Score = 62.4 bits (150), Expect = 8e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNV 831 RSEKKSRKAMLKLGMKPVTGVSRV+IKRTKNV Sbjct: 61 RSEKKSRKAMLKLGMKPVTGVSRVTIKRTKNV 92 >ref|XP_009769959.1| PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 2 [Nicotiana sylvestris] Length = 207 Score = 62.4 bits (150), Expect = 8e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNV 831 RSEKKSRKAMLKLGMKPVTGVSRV+IKRTKNV Sbjct: 61 RSEKKSRKAMLKLGMKPVTGVSRVTIKRTKNV 92 >ref|XP_009605401.1| PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 2 [Nicotiana tomentosiformis] ref|XP_016445058.1| PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 2 [Nicotiana tabacum] Length = 208 Score = 62.4 bits (150), Expect = 8e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNV 831 RSEKKSRKAMLKLGMKPVTGVSRV+IKRTKNV Sbjct: 63 RSEKKSRKAMLKLGMKPVTGVSRVTIKRTKNV 94 >gb|KFK34228.1| hypothetical protein AALP_AA5G117600 [Arabis alpina] Length = 208 Score = 62.4 bits (150), Expect = 8e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNV 831 RSEKKSRKAMLKLGMKPVTGVSRV+IKRTKNV Sbjct: 62 RSEKKSRKAMLKLGMKPVTGVSRVTIKRTKNV 93 >ref|XP_022891140.1| nascent polypeptide-associated complex subunit alpha-like protein 2 [Olea europaea var. sylvestris] Length = 210 Score = 62.4 bits (150), Expect = 9e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNV 831 RSEKKSRKAMLKLGMKPVTGV+RVSIKRTKNV Sbjct: 60 RSEKKSRKAMLKLGMKPVTGVNRVSIKRTKNV 91 >gb|AAK48972.1|AF370545_1 alpha NAC-like protein [Arabidopsis thaliana] gb|AAL66951.1| alpha NAC-like protein [Arabidopsis thaliana] Length = 217 Score = 62.4 bits (150), Expect = 9e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNV 831 RSEKKSRKAMLKLGMKPVTGVSRV+IKRTKNV Sbjct: 71 RSEKKSRKAMLKLGMKPVTGVSRVTIKRTKNV 102 >gb|KJB52489.1| hypothetical protein B456_008G264600 [Gossypium raimondii] Length = 217 Score = 62.4 bits (150), Expect = 9e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNV 831 RSEKKSRKAMLKLGMKPVTGVSRV+IKRTKNV Sbjct: 72 RSEKKSRKAMLKLGMKPVTGVSRVTIKRTKNV 103 >ref|NP_190516.1| nascent polypeptide-associated complex subunit alpha-like protein 2 [Arabidopsis thaliana] sp|Q94JX9.2|NACA2_ARATH RecName: Full=Nascent polypeptide-associated complex subunit alpha-like protein 2; Short=NAC-alpha-like protein 2; AltName: Full=Alpha-NAC-like protein 2 gb|AAG52192.1|AC012329_19 putative alpha NAC; 61864-63065 [Arabidopsis thaliana] emb|CAB62452.1| alpha NAC-like protein [Arabidopsis thaliana] gb|AEE78547.1| nascent polypeptide-associated complex subunit alpha-like protein 2 [Arabidopsis thaliana] gb|OAP06814.1| NACA2 [Arabidopsis thaliana] Length = 217 Score = 62.4 bits (150), Expect = 9e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNV 831 RSEKKSRKAMLKLGMKPVTGVSRV+IKRTKNV Sbjct: 71 RSEKKSRKAMLKLGMKPVTGVSRVTIKRTKNV 102 >ref|XP_002875967.1| nascent polypeptide-associated complex subunit alpha-like protein 2 [Arabidopsis lyrata subsp. lyrata] gb|EFH52226.1| nascent polypeptide-associated complex domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 217 Score = 62.4 bits (150), Expect = 9e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNV 831 RSEKKSRKAMLKLGMKPVTGVSRV+IKRTKNV Sbjct: 71 RSEKKSRKAMLKLGMKPVTGVSRVTIKRTKNV 102 >ref|XP_010503604.1| PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 2 [Camelina sativa] Length = 218 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNV 831 RSEKKSRKAMLKLGMKPVTGVSRV+IKRTKNV Sbjct: 72 RSEKKSRKAMLKLGMKPVTGVSRVTIKRTKNV 103 >ref|XP_012439931.1| PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 2 [Gossypium raimondii] ref|XP_016737246.1| PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 2 [Gossypium hirsutum] gb|KJB52488.1| hypothetical protein B456_008G264600 [Gossypium raimondii] Length = 220 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 926 RSEKKSRKAMLKLGMKPVTGVSRVSIKRTKNV 831 RSEKKSRKAMLKLGMKPVTGVSRV+IKRTKNV Sbjct: 75 RSEKKSRKAMLKLGMKPVTGVSRVTIKRTKNV 106