BLASTX nr result
ID: Cheilocostus21_contig00022419
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00022419 (616 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009407533.1| PREDICTED: mitochondrial uncoupling protein ... 91 2e-18 ref|XP_009416184.1| PREDICTED: mitochondrial uncoupling protein ... 91 4e-18 dbj|BAA92173.1| uncoupling protein b [Symplocarpus renifolius] 90 4e-18 dbj|BAI49703.1| uncoupling protein [Lysichiton camtschatcensis] 90 7e-18 ref|XP_020674955.1| mitochondrial uncoupling protein 1 [Dendrobi... 88 4e-17 ref|XP_020101196.1| mitochondrial uncoupling protein 1-like [Ana... 87 7e-17 gb|OAY82667.1| Mitochondrial uncoupling protein 1 [Ananas comosus] 87 7e-17 ref|XP_020252421.1| mitochondrial uncoupling protein 1-like [Asp... 87 1e-16 ref|XP_008798955.1| PREDICTED: mitochondrial uncoupling protein ... 86 1e-16 dbj|BAA92172.1| uncoupling protein a [Symplocarpus renifolius] 86 2e-16 ref|XP_020274390.1| mitochondrial uncoupling protein 1-like [Asp... 86 2e-16 dbj|BAI49702.1| uncoupling protein a [Symplocarpus renifolius] 86 2e-16 ref|XP_010262729.1| PREDICTED: mitochondrial uncoupling protein ... 86 3e-16 gb|AFK41504.1| unknown [Medicago truncatula] 79 3e-16 gb|ABK26343.1| unknown [Picea sitchensis] 85 4e-16 ref|XP_020599378.1| mitochondrial uncoupling protein 1 isoform X... 85 4e-16 ref|XP_020599370.1| mitochondrial uncoupling protein 1 isoform X... 85 4e-16 dbj|BAD51464.1| uncoupling protein a [Dracunculus vulgaris] 85 5e-16 dbj|BAC06495.1| mitochondrial uncoupling protein [Helicodiceros ... 85 5e-16 dbj|BAL41370.1| uncoupling protein [Arum maculatum] 85 5e-16 >ref|XP_009407533.1| PREDICTED: mitochondrial uncoupling protein 1-like [Musa acuminata subsp. malaccensis] Length = 303 Score = 91.3 bits (225), Expect = 2e-18 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEIP 485 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKK FA+E+P Sbjct: 259 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKLFAREVP 302 >ref|XP_009416184.1| PREDICTED: mitochondrial uncoupling protein 1-like [Musa acuminata subsp. malaccensis] Length = 303 Score = 90.5 bits (223), Expect = 4e-18 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEIP 485 TMKNEGPLAFYKGF+PNFGRLGSWNVIMFLTLEQVKK FA+E+P Sbjct: 259 TMKNEGPLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKLFAREVP 302 >dbj|BAA92173.1| uncoupling protein b [Symplocarpus renifolius] Length = 268 Score = 89.7 bits (221), Expect = 4e-18 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEIP 485 T+KN+GPLAFYKGF+PNFGRLGSWNVIMFLTLEQVKKFF KE+P Sbjct: 224 TLKNDGPLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKFFIKEVP 267 >dbj|BAI49703.1| uncoupling protein [Lysichiton camtschatcensis] Length = 304 Score = 89.7 bits (221), Expect = 7e-18 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEIP 485 T+KN+GPLAFYKGF+PNFGRLGSWNVIMFLTLEQVKKFF KE+P Sbjct: 260 TLKNDGPLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKFFIKEVP 303 >ref|XP_020674955.1| mitochondrial uncoupling protein 1 [Dendrobium catenatum] gb|PKU87278.1| Mitochondrial uncoupling protein 1 [Dendrobium catenatum] Length = 306 Score = 87.8 bits (216), Expect = 4e-17 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEIP 485 T+KN+GPLAFYKGF+PNFGRLGSWNVIMFLTLEQVKK F KE+P Sbjct: 262 TLKNDGPLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKLFTKEVP 305 >ref|XP_020101196.1| mitochondrial uncoupling protein 1-like [Ananas comosus] Length = 305 Score = 87.0 bits (214), Expect = 7e-17 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEIP 485 T+KNEGPLAFYKGF+PNFGRLGSWNVIMFLTLEQVKK F K++P Sbjct: 261 TLKNEGPLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKLFEKKVP 304 >gb|OAY82667.1| Mitochondrial uncoupling protein 1 [Ananas comosus] Length = 305 Score = 87.0 bits (214), Expect = 7e-17 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEIP 485 T+KNEGPLAFYKGF+PNFGRLGSWNVIMFLTLEQVKK F K++P Sbjct: 261 TLKNEGPLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKLFEKKVP 304 >ref|XP_020252421.1| mitochondrial uncoupling protein 1-like [Asparagus officinalis] Length = 304 Score = 86.7 bits (213), Expect = 1e-16 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEI 488 T+KN+GPLAFYKGF+PNFGRLGSWNVIMFLTLEQVKK FAKE+ Sbjct: 260 TLKNDGPLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKLFAKEV 302 >ref|XP_008798955.1| PREDICTED: mitochondrial uncoupling protein 1 [Phoenix dactylifera] Length = 305 Score = 86.3 bits (212), Expect = 1e-16 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEI 488 T+KN+GP AFYKGF+PNFGRLGSWNVIMFLTLEQVKKFFA+E+ Sbjct: 261 TLKNDGPFAFYKGFIPNFGRLGSWNVIMFLTLEQVKKFFAREV 303 >dbj|BAA92172.1| uncoupling protein a [Symplocarpus renifolius] Length = 303 Score = 85.9 bits (211), Expect = 2e-16 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEIP 485 T+KN+G LAFYKGF+PNFGRLGSWNVIMFLTLEQVKKFF KE+P Sbjct: 259 TLKNDGLLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKFFIKEVP 302 >ref|XP_020274390.1| mitochondrial uncoupling protein 1-like [Asparagus officinalis] gb|ONK62113.1| uncharacterized protein A4U43_C07F490 [Asparagus officinalis] Length = 304 Score = 85.9 bits (211), Expect = 2e-16 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEIP 485 T+KN+GPLAFYKGF+PNF RLGSWNVIMFLTLEQVKKFFA+ +P Sbjct: 260 TLKNDGPLAFYKGFIPNFARLGSWNVIMFLTLEQVKKFFARAVP 303 >dbj|BAI49702.1| uncoupling protein a [Symplocarpus renifolius] Length = 304 Score = 85.9 bits (211), Expect = 2e-16 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEIP 485 T+KN+G LAFYKGF+PNFGRLGSWNVIMFLTLEQVKKFF KE+P Sbjct: 260 TLKNDGLLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKFFIKEVP 303 >ref|XP_010262729.1| PREDICTED: mitochondrial uncoupling protein 1-like [Nelumbo nucifera] Length = 303 Score = 85.5 bits (210), Expect = 3e-16 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEI 488 T+KN+GPLAFYKGF+PNFGRLGSWNVIMFLTLEQ KKFF KE+ Sbjct: 261 TLKNDGPLAFYKGFIPNFGRLGSWNVIMFLTLEQAKKFFRKEV 303 >gb|AFK41504.1| unknown [Medicago truncatula] Length = 61 Score = 79.3 bits (194), Expect = 3e-16 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKF 503 T+KN+GPLAFYKGFLPNFGRLGSWNVIMFLTLEQ KKF Sbjct: 17 TLKNDGPLAFYKGFLPNFGRLGSWNVIMFLTLEQAKKF 54 >gb|ABK26343.1| unknown [Picea sitchensis] Length = 304 Score = 85.1 bits (209), Expect = 4e-16 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEIP 485 T+K +GPLAFYKGF+PNFGRLGSWNVIMFLTLEQVKK FA+E+P Sbjct: 260 TLKYDGPLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKLFAREVP 303 >ref|XP_020599378.1| mitochondrial uncoupling protein 1 isoform X2 [Phalaenopsis equestris] Length = 306 Score = 85.1 bits (209), Expect = 4e-16 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEIP 485 T++N+GPLAFYKGF+PNFGRLGSWNVIMFLTLEQVKK F +E+P Sbjct: 262 TLRNDGPLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKLFIREVP 305 >ref|XP_020599370.1| mitochondrial uncoupling protein 1 isoform X1 [Phalaenopsis equestris] Length = 308 Score = 85.1 bits (209), Expect = 4e-16 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEIP 485 T++N+GPLAFYKGF+PNFGRLGSWNVIMFLTLEQVKK F +E+P Sbjct: 264 TLRNDGPLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKLFIREVP 307 >dbj|BAD51464.1| uncoupling protein a [Dracunculus vulgaris] Length = 304 Score = 84.7 bits (208), Expect = 5e-16 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEIP 485 T KN+GPLAFYKGF+PNFGRLGSWNVIMFLTLEQVKK F KE P Sbjct: 261 TFKNDGPLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKVFIKEAP 304 >dbj|BAC06495.1| mitochondrial uncoupling protein [Helicodiceros muscivorus] Length = 304 Score = 84.7 bits (208), Expect = 5e-16 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEIP 485 T KN+GPLAFYKGF+PNFGRLGSWNVIMFLTLEQVKK F KE P Sbjct: 261 TFKNDGPLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKVFIKEAP 304 >dbj|BAL41370.1| uncoupling protein [Arum maculatum] Length = 304 Score = 84.7 bits (208), Expect = 5e-16 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -1 Query: 616 TMKNEGPLAFYKGFLPNFGRLGSWNVIMFLTLEQVKKFFAKEIP 485 T KN+GPLAFYKGF+PNFGRLGSWNVIMFLTLEQVKK F KE P Sbjct: 261 TFKNDGPLAFYKGFIPNFGRLGSWNVIMFLTLEQVKKVFIKEAP 304