BLASTX nr result
ID: Cheilocostus21_contig00022170
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00022170 (405 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018677263.1| PREDICTED: STOREKEEPER protein-like [Musa ac... 74 8e-13 >ref|XP_018677263.1| PREDICTED: STOREKEEPER protein-like [Musa acuminata subsp. malaccensis] Length = 457 Score = 74.3 bits (181), Expect = 8e-13 Identities = 37/64 (57%), Positives = 48/64 (75%), Gaps = 2/64 (3%) Frame = -1 Query: 186 IKPINSKPMDSPTRSGKPAVTRAPTPAQDSLRRKGDSVDSSQKDNNGG--RQFFQRLWSL 13 IKPIN+KPMD+P + K A + AP ++SL+RK D V+ S+ DN+GG RQ FQRLWSL Sbjct: 173 IKPINTKPMDTPNKPSKQANSPAPLQDRESLKRKHDVVERSELDNHGGQKRQLFQRLWSL 232 Query: 12 DDEI 1 D+EI Sbjct: 233 DNEI 236