BLASTX nr result
ID: Cheilocostus21_contig00021996
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00021996 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020674922.1| probable calcium-binding protein CML36 [Dend... 53 9e-06 >ref|XP_020674922.1| probable calcium-binding protein CML36 [Dendrobium catenatum] gb|PKU84831.1| putative calcium-binding protein CML36 [Dendrobium catenatum] Length = 195 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/43 (60%), Positives = 33/43 (76%), Gaps = 2/43 (4%) Frame = +1 Query: 280 NNAGPQSTPKSVLPKHDPSL--HDLFSVFDLDGDGKITQRELE 402 N++ TPKSV+P+H+ S+ DLF VFD DGDGKIT+RELE Sbjct: 35 NSSSDDLTPKSVIPRHEFSVAVSDLFGVFDRDGDGKITKRELE 77