BLASTX nr result
ID: Cheilocostus21_contig00021735
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00021735 (504 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009408682.1| PREDICTED: mitochondrial outer membrane prot... 107 4e-25 ref|XP_010925058.1| PREDICTED: mitochondrial outer membrane prot... 106 6e-25 ref|XP_008808420.1| PREDICTED: mitochondrial outer membrane prot... 104 4e-24 ref|XP_010932447.1| PREDICTED: mitochondrial outer membrane prot... 103 1e-23 ref|XP_020087656.1| mitochondrial outer membrane protein porin 1... 102 2e-23 gb|OAY77772.1| Mitochondrial outer membrane protein porin 1 [Ana... 101 4e-23 ref|XP_020099164.1| mitochondrial outer membrane protein porin 1... 101 6e-23 ref|XP_009410756.1| PREDICTED: mitochondrial outer membrane prot... 100 1e-22 ref|XP_008786741.1| PREDICTED: mitochondrial outer membrane prot... 100 3e-22 gb|ONK76605.1| uncharacterized protein A4U43_C03F30040 [Asparagu... 99 3e-22 ref|XP_020106293.1| mitochondrial outer membrane protein porin 1... 99 3e-22 gb|OAY64538.1| Mitochondrial outer membrane protein porin 1 [Ana... 99 3e-22 ref|XP_010925360.1| PREDICTED: mitochondrial outer membrane prot... 99 3e-22 ref|XP_020259225.1| mitochondrial outer membrane protein porin 1... 99 5e-22 gb|AAY82249.1| mitochrondrial voltage-dependent anion-selective ... 99 5e-22 ref|XP_009393634.1| PREDICTED: mitochondrial outer membrane prot... 99 7e-22 ref|XP_019452936.1| PREDICTED: outer plastidial membrane protein... 99 7e-22 ref|XP_019427697.1| PREDICTED: outer plastidial membrane protein... 99 7e-22 ref|XP_017419240.1| PREDICTED: outer plastidial membrane protein... 99 7e-22 ref|XP_020213230.1| outer plastidial membrane protein porin-like... 99 7e-22 >ref|XP_009408682.1| PREDICTED: mitochondrial outer membrane protein porin 1-like [Musa acuminata subsp. malaccensis] Length = 275 Score = 107 bits (266), Expect = 4e-25 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLTT+KARFN+YGKASALIQHEWKPKSFFTISGEVDTKA+EKSSK+GLSLVLKP Sbjct: 222 PLTTIKARFNNYGKASALIQHEWKPKSFFTISGEVDTKAIEKSSKIGLSLVLKP 275 >ref|XP_010925058.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Elaeis guineensis] Length = 275 Score = 106 bits (265), Expect = 6e-25 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLTTVKARFN+YGKASALIQHEW+PKSFFTISGEVDTKA+EKSSKVGLSLVLKP Sbjct: 222 PLTTVKARFNNYGKASALIQHEWRPKSFFTISGEVDTKAIEKSSKVGLSLVLKP 275 >ref|XP_008808420.1| PREDICTED: mitochondrial outer membrane protein porin 1-like [Phoenix dactylifera] Length = 275 Score = 104 bits (259), Expect = 4e-24 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLT VKARFN+YGKASALIQHEW+PKSFFTISGEVDTKA+EKSSKVGLSLVLKP Sbjct: 222 PLTMVKARFNNYGKASALIQHEWRPKSFFTISGEVDTKAIEKSSKVGLSLVLKP 275 >ref|XP_010932447.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Elaeis guineensis] Length = 275 Score = 103 bits (256), Expect = 1e-23 Identities = 49/54 (90%), Positives = 53/54 (98%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLT VKARFN+YGKASALIQHEW+PKSFFTISGEVDTKA+EKSSKVGLSLVL+P Sbjct: 222 PLTLVKARFNNYGKASALIQHEWRPKSFFTISGEVDTKAIEKSSKVGLSLVLRP 275 >ref|XP_020087656.1| mitochondrial outer membrane protein porin 1-like [Ananas comosus] gb|OAY65386.1| Mitochondrial outer membrane protein porin 1 [Ananas comosus] Length = 275 Score = 102 bits (254), Expect = 2e-23 Identities = 48/54 (88%), Positives = 53/54 (98%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLTTVKARFN++GKASALIQHEW+PKSFFT+S EVDTKA+EKSSKVGLSLVLKP Sbjct: 222 PLTTVKARFNNFGKASALIQHEWRPKSFFTVSAEVDTKAIEKSSKVGLSLVLKP 275 >gb|OAY77772.1| Mitochondrial outer membrane protein porin 1 [Ananas comosus] Length = 247 Score = 101 bits (251), Expect = 4e-23 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLTTVKARFN+YGKASALIQHEW+PKSF TIS EVDTKA+EKSSKVGLSLVLKP Sbjct: 194 PLTTVKARFNNYGKASALIQHEWRPKSFLTISTEVDTKAIEKSSKVGLSLVLKP 247 >ref|XP_020099164.1| mitochondrial outer membrane protein porin 1-like [Ananas comosus] Length = 273 Score = 101 bits (251), Expect = 6e-23 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLTTVKARFN+YGKASALIQHEW+PKSF TIS EVDTKA+EKSSKVGLSLVLKP Sbjct: 220 PLTTVKARFNNYGKASALIQHEWRPKSFLTISTEVDTKAIEKSSKVGLSLVLKP 273 >ref|XP_009410756.1| PREDICTED: mitochondrial outer membrane protein porin 1-like [Musa acuminata subsp. malaccensis] Length = 275 Score = 100 bits (249), Expect = 1e-22 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLTT KARFN+YGKASALIQHEWKPKSF TISGEVDTKA+E SSK+GLSLVL+P Sbjct: 222 PLTTAKARFNNYGKASALIQHEWKPKSFLTISGEVDTKAIENSSKIGLSLVLRP 275 >ref|XP_008786741.1| PREDICTED: mitochondrial outer membrane protein porin 1-like [Phoenix dactylifera] Length = 276 Score = 99.8 bits (247), Expect = 3e-22 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLT VKARFN+YGKASALIQHEW+PKSF TI+GEVDTKA+EKSSKVGLSLVL+P Sbjct: 223 PLTLVKARFNNYGKASALIQHEWRPKSFLTITGEVDTKAIEKSSKVGLSLVLRP 276 >gb|ONK76605.1| uncharacterized protein A4U43_C03F30040 [Asparagus officinalis] Length = 245 Score = 99.0 bits (245), Expect = 3e-22 Identities = 46/54 (85%), Positives = 53/54 (98%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLTTVKARF++YG+ASAL+QH+W+PKSF TISGEVDTKA+EKSSKVGLSLVLKP Sbjct: 192 PLTTVKARFDNYGRASALLQHQWRPKSFVTISGEVDTKAIEKSSKVGLSLVLKP 245 >ref|XP_020106293.1| mitochondrial outer membrane protein porin 1-like [Ananas comosus] Length = 275 Score = 99.4 bits (246), Expect = 3e-22 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLTTVKARFN+YGKASALIQHEW+PKS FT+S EVDT A+EKSSKVGLSLVLKP Sbjct: 222 PLTTVKARFNNYGKASALIQHEWRPKSLFTVSAEVDTTAIEKSSKVGLSLVLKP 275 >gb|OAY64538.1| Mitochondrial outer membrane protein porin 1 [Ananas comosus] Length = 275 Score = 99.4 bits (246), Expect = 3e-22 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLTTVKARFN+YGKASALIQHEW+PKS FT+S EVDT A+EKSSKVGLSLVLKP Sbjct: 222 PLTTVKARFNNYGKASALIQHEWRPKSLFTVSAEVDTTAIEKSSKVGLSLVLKP 275 >ref|XP_010925360.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Elaeis guineensis] Length = 275 Score = 99.4 bits (246), Expect = 3e-22 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLT VKARFN+YGKASALIQHEW+PKSF T++GEVDTKA+EKSSKVGLSLVL+P Sbjct: 222 PLTLVKARFNNYGKASALIQHEWRPKSFLTVTGEVDTKAIEKSSKVGLSLVLRP 275 >ref|XP_020259225.1| mitochondrial outer membrane protein porin 1-like [Asparagus officinalis] Length = 275 Score = 99.0 bits (245), Expect = 5e-22 Identities = 46/54 (85%), Positives = 53/54 (98%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLTTVKARF++YG+ASAL+QH+W+PKSF TISGEVDTKA+EKSSKVGLSLVLKP Sbjct: 222 PLTTVKARFDNYGRASALLQHQWRPKSFVTISGEVDTKAIEKSSKVGLSLVLKP 275 >gb|AAY82249.1| mitochrondrial voltage-dependent anion-selective channel [Phaseolus coccineus] Length = 276 Score = 99.0 bits (245), Expect = 5e-22 Identities = 46/54 (85%), Positives = 53/54 (98%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLTT+KAR N++GK+SALIQHEW+PKSFFTISGEVDTKA+EKS+KVGLSLVLKP Sbjct: 223 PLTTLKARVNNFGKSSALIQHEWRPKSFFTISGEVDTKAIEKSAKVGLSLVLKP 276 >ref|XP_009393634.1| PREDICTED: mitochondrial outer membrane protein porin 1-like [Musa acuminata subsp. malaccensis] ref|XP_018678893.1| PREDICTED: mitochondrial outer membrane protein porin 1-like [Musa acuminata subsp. malaccensis] Length = 275 Score = 98.6 bits (244), Expect = 7e-22 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = -3 Query: 499 LTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 LTTVK R NSYGKASALIQHEWKPKSF TISGE+DTKA+EKSSKVGLSLVL+P Sbjct: 223 LTTVKGRINSYGKASALIQHEWKPKSFLTISGEIDTKAIEKSSKVGLSLVLRP 275 >ref|XP_019452936.1| PREDICTED: outer plastidial membrane protein porin-like [Lupinus angustifolius] gb|OIW06703.1| hypothetical protein TanjilG_04097 [Lupinus angustifolius] Length = 276 Score = 98.6 bits (244), Expect = 7e-22 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLTTVKAR N++GKA+ALIQHEW+PKSFFTISGEVDTKA+EKS+KVGL LVLKP Sbjct: 223 PLTTVKARVNNFGKANALIQHEWRPKSFFTISGEVDTKAIEKSAKVGLGLVLKP 276 >ref|XP_019427697.1| PREDICTED: outer plastidial membrane protein porin-like [Lupinus angustifolius] gb|OIV90272.1| hypothetical protein TanjilG_08309 [Lupinus angustifolius] Length = 276 Score = 98.6 bits (244), Expect = 7e-22 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLTTVKAR N++GKA+ALIQHEW+PKSFFTISGEVDTKA+EKS+KVGLSL LKP Sbjct: 223 PLTTVKARVNNFGKANALIQHEWRPKSFFTISGEVDTKAIEKSAKVGLSLALKP 276 >ref|XP_017419240.1| PREDICTED: outer plastidial membrane protein porin-like [Vigna angularis] Length = 276 Score = 98.6 bits (244), Expect = 7e-22 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLTT+KAR N++GK SALIQHEW+PKSFFTISGEVDTKA+EKS+KVGLSLVLKP Sbjct: 223 PLTTLKARVNNFGKTSALIQHEWRPKSFFTISGEVDTKAIEKSAKVGLSLVLKP 276 >ref|XP_020213230.1| outer plastidial membrane protein porin-like [Cajanus cajan] gb|KYP69278.1| Outer plastidial membrane protein porin [Cajanus cajan] Length = 276 Score = 98.6 bits (244), Expect = 7e-22 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -3 Query: 502 PLTTVKARFNSYGKASALIQHEWKPKSFFTISGEVDTKAVEKSSKVGLSLVLKP 341 PLTT+KAR N++GK SALIQHEW+PKSFFTISGEVDTKA+EKS+KVGLSLVLKP Sbjct: 223 PLTTLKARVNNFGKTSALIQHEWRPKSFFTISGEVDTKAIEKSAKVGLSLVLKP 276