BLASTX nr result
ID: Cheilocostus21_contig00021603
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00021603 (539 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010926646.1| PREDICTED: rho GDP-dissociation inhibitor 1 ... 55 6e-06 ref|XP_020088954.1| rho GDP-dissociation inhibitor 1-like [Anana... 55 7e-06 gb|PKA54503.1| Rho GDP-dissociation inhibitor 1 [Apostasia shenz... 55 8e-06 >ref|XP_010926646.1| PREDICTED: rho GDP-dissociation inhibitor 1 [Elaeis guineensis] ref|XP_019707295.1| PREDICTED: rho GDP-dissociation inhibitor 1 [Elaeis guineensis] Length = 255 Score = 55.5 bits (132), Expect = 6e-06 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 6/50 (12%) Frame = +1 Query: 406 KIDRKFSSASLVSVDG------EDDEDEQRRKMLLGPQIGLKEQLEMDKD 537 K+ RKFS S+ S D EDD+DE +R + LGPQ+ LKEQLEMDKD Sbjct: 44 KLSRKFSCTSVASTDNDDEIGDEDDDDEDKRAVQLGPQVPLKEQLEMDKD 93 >ref|XP_020088954.1| rho GDP-dissociation inhibitor 1-like [Ananas comosus] gb|OAY76049.1| Rho GDP-dissociation inhibitor 1 [Ananas comosus] Length = 234 Score = 55.1 bits (131), Expect = 7e-06 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 6/50 (12%) Frame = +1 Query: 406 KIDRKFSSASLVSVD------GEDDEDEQRRKMLLGPQIGLKEQLEMDKD 537 K+ RKFS AS+ S D +DD DE+++ +LLGPQ+ LKEQLEMDKD Sbjct: 23 KLSRKFSCASVSSTDMNDDDGSDDDGDEEKQAVLLGPQVPLKEQLEMDKD 72 >gb|PKA54503.1| Rho GDP-dissociation inhibitor 1 [Apostasia shenzhenica] Length = 245 Score = 55.1 bits (131), Expect = 8e-06 Identities = 29/51 (56%), Positives = 35/51 (68%), Gaps = 7/51 (13%) Frame = +1 Query: 406 KIDRKFSSASLVSVDG-------EDDEDEQRRKMLLGPQIGLKEQLEMDKD 537 KI RKFSSASL S DG +DD+D+ + LLGPQ+ LK+QLE DKD Sbjct: 34 KITRKFSSASLCSTDGGEDVDDDDDDDDDDKTPGLLGPQLALKDQLEKDKD 84