BLASTX nr result
ID: Cheilocostus21_contig00021474
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00021474 (484 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019708833.1| PREDICTED: transcription repressor OFP4 isof... 62 2e-08 ref|XP_018828493.1| PREDICTED: transcription repressor OFP4-like... 62 2e-08 ref|XP_010931348.1| PREDICTED: transcription repressor OFP3 isof... 62 2e-08 ref|XP_009402214.1| PREDICTED: transcription repressor OFP1-like... 62 2e-08 gb|PKA67140.1| hypothetical protein AXF42_Ash004632 [Apostasia s... 61 3e-08 ref|XP_021977820.1| transcription repressor OFP1-like [Helianthu... 61 5e-08 ref|XP_020113634.1| LOW QUALITY PROTEIN: transcription repressor... 61 6e-08 gb|OAY70438.1| Transcription repressor OFP3 [Ananas comosus] 61 6e-08 gb|PKA57630.1| hypothetical protein AXF42_Ash016676 [Apostasia s... 60 8e-08 ref|XP_010108488.1| transcription repressor OFP1 [Morus notabili... 61 8e-08 ref|XP_018835668.1| PREDICTED: transcription repressor OFP4-like... 61 8e-08 ref|XP_002276629.1| PREDICTED: transcription repressor OFP4 [Vit... 61 8e-08 ref|XP_008792265.1| PREDICTED: transcription repressor OFP2-like... 61 8e-08 gb|PPR82253.1| hypothetical protein GOBAR_AA38464 [Gossypium bar... 60 9e-08 ref|XP_016715134.1| PREDICTED: transcription repressor OFP1-like... 60 9e-08 ref|XP_012487101.1| PREDICTED: transcription repressor OFP1-like... 60 9e-08 gb|PON37668.1| Ovate protein [Parasponia andersonii] 60 1e-07 ref|XP_018819286.1| PREDICTED: transcription repressor OFP1 [Jug... 60 1e-07 ref|XP_022032675.1| transcription repressor OFP3-like [Helianthu... 60 1e-07 gb|OTG28685.1| putative ovate protein family, DNA-binding domain... 60 1e-07 >ref|XP_019708833.1| PREDICTED: transcription repressor OFP4 isoform X2 [Elaeis guineensis] Length = 366 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDLGGV 386 EELLACYLSLNS EYHGVIVK FEQIWFDL + Sbjct: 332 EELLACYLSLNSKEYHGVIVKVFEQIWFDLTNI 364 >ref|XP_018828493.1| PREDICTED: transcription repressor OFP4-like [Juglans regia] Length = 386 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDLGGV 386 E+LLACYLSLNS+EYHG+IVKAFEQIWF++ G+ Sbjct: 352 EDLLACYLSLNSNEYHGLIVKAFEQIWFEMAGL 384 >ref|XP_010931348.1| PREDICTED: transcription repressor OFP3 isoform X1 [Elaeis guineensis] Length = 388 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDLGGV 386 EELLACYLSLNS EYHGVIVK FEQIWFDL + Sbjct: 354 EELLACYLSLNSKEYHGVIVKVFEQIWFDLTNI 386 >ref|XP_009402214.1| PREDICTED: transcription repressor OFP1-like [Musa acuminata subsp. malaccensis] Length = 393 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDL 395 EELLACYLSLNSDEYH VIVKAF+QIWFDL Sbjct: 358 EELLACYLSLNSDEYHDVIVKAFQQIWFDL 387 >gb|PKA67140.1| hypothetical protein AXF42_Ash004632 [Apostasia shenzhenica] Length = 249 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDL 395 EELLACYLSLNSDEYH +IVK FEQIWFDL Sbjct: 216 EELLACYLSLNSDEYHEIIVKVFEQIWFDL 245 >ref|XP_021977820.1| transcription repressor OFP1-like [Helianthus annuus] gb|OTG18928.1| putative ovate family protein 2 [Helianthus annuus] Length = 308 Score = 61.2 bits (147), Expect = 5e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDL 395 EELLACYLSLNSDEYH VIVKAFEQIWF L Sbjct: 276 EELLACYLSLNSDEYHDVIVKAFEQIWFSL 305 >ref|XP_020113634.1| LOW QUALITY PROTEIN: transcription repressor OFP1-like [Ananas comosus] Length = 427 Score = 61.2 bits (147), Expect = 6e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDL 395 E+LLACYLSLNSDEYH +IVKAFEQIWFDL Sbjct: 395 EDLLACYLSLNSDEYHDLIVKAFEQIWFDL 424 >gb|OAY70438.1| Transcription repressor OFP3 [Ananas comosus] Length = 431 Score = 61.2 bits (147), Expect = 6e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDL 395 E+LLACYLSLNSDEYH +IVKAFEQIWFDL Sbjct: 399 EDLLACYLSLNSDEYHDLIVKAFEQIWFDL 428 >gb|PKA57630.1| hypothetical protein AXF42_Ash016676 [Apostasia shenzhenica] Length = 233 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDL 395 EELLACYLSLNSDEYHGVI+ F+QIWFDL Sbjct: 201 EELLACYLSLNSDEYHGVILDVFQQIWFDL 230 >ref|XP_010108488.1| transcription repressor OFP1 [Morus notabilis] gb|EXC19550.1| hypothetical protein L484_010681 [Morus notabilis] Length = 364 Score = 60.8 bits (146), Expect = 8e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDLGGV 386 EELLACYLSLNS EYH VIVKAFEQIWFD+ + Sbjct: 330 EELLACYLSLNSKEYHDVIVKAFEQIWFDMADI 362 >ref|XP_018835668.1| PREDICTED: transcription repressor OFP4-like [Juglans regia] Length = 368 Score = 60.8 bits (146), Expect = 8e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDLGGV 386 E+LLACYLSLNSDEYH +IVKAFEQIWFD+ + Sbjct: 334 EDLLACYLSLNSDEYHDLIVKAFEQIWFDMASL 366 >ref|XP_002276629.1| PREDICTED: transcription repressor OFP4 [Vitis vinifera] Length = 387 Score = 60.8 bits (146), Expect = 8e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFD 398 EELLACYLSLNSDEYH +IVKAFEQIWFD Sbjct: 353 EELLACYLSLNSDEYHDLIVKAFEQIWFD 381 >ref|XP_008792265.1| PREDICTED: transcription repressor OFP2-like [Phoenix dactylifera] Length = 388 Score = 60.8 bits (146), Expect = 8e-08 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDLGGV 386 EELLACYLSLNSDEYH VIVKAFEQIWF L + Sbjct: 354 EELLACYLSLNSDEYHEVIVKAFEQIWFHLTNI 386 >gb|PPR82253.1| hypothetical protein GOBAR_AA38464 [Gossypium barbadense] Length = 293 Score = 60.5 bits (145), Expect = 9e-08 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDLGGV 386 E+LLACYLSLNSDEYH VI+K F+QIWFDL V Sbjct: 258 EDLLACYLSLNSDEYHDVIIKVFKQIWFDLSNV 290 >ref|XP_016715134.1| PREDICTED: transcription repressor OFP1-like [Gossypium hirsutum] Length = 293 Score = 60.5 bits (145), Expect = 9e-08 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDLGGV 386 E+LLACYLSLNSDEYH VI+K F+QIWFDL V Sbjct: 258 EDLLACYLSLNSDEYHDVIIKVFKQIWFDLSNV 290 >ref|XP_012487101.1| PREDICTED: transcription repressor OFP1-like [Gossypium raimondii] gb|KJB38050.1| hypothetical protein B456_006G234600 [Gossypium raimondii] Length = 295 Score = 60.5 bits (145), Expect = 9e-08 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDLGGV 386 E+LLACYLSLNSDEYH VI+K F+QIWFDL V Sbjct: 260 EDLLACYLSLNSDEYHDVIIKVFKQIWFDLSNV 292 >gb|PON37668.1| Ovate protein [Parasponia andersonii] Length = 359 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDLGGV 386 EELLACYLSLNS EYH +IVKAFEQIWFD+ V Sbjct: 325 EELLACYLSLNSKEYHDIIVKAFEQIWFDMAHV 357 >ref|XP_018819286.1| PREDICTED: transcription repressor OFP1 [Juglans regia] Length = 397 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDLGGVDP 380 E+LLACYLSLNSDEYH +I+K F+QIWFDL V P Sbjct: 362 EDLLACYLSLNSDEYHELIIKVFKQIWFDLTDVQP 396 >ref|XP_022032675.1| transcription repressor OFP3-like [Helianthus annuus] Length = 404 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDLGGV 386 EELLACYL+LNSDEYH VIVKAFEQIWF L V Sbjct: 372 EELLACYLALNSDEYHDVIVKAFEQIWFSLPDV 404 >gb|OTG28685.1| putative ovate protein family, DNA-binding domain, ovate family-like protein [Helianthus annuus] Length = 414 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 484 EELLACYLSLNSDEYHGVIVKAFEQIWFDLGGV 386 EELLACYL+LNSDEYH VIVKAFEQIWF L V Sbjct: 382 EELLACYLALNSDEYHDVIVKAFEQIWFSLPDV 414