BLASTX nr result
ID: Cheilocostus21_contig00021270
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00021270 (703 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009415235.1| PREDICTED: plant cysteine oxidase 4 [Musa ac... 71 5e-11 ref|XP_009392425.1| PREDICTED: plant cysteine oxidase 4 [Musa ac... 65 8e-09 ref|XP_020100708.1| plant cysteine oxidase 4-like isoform X3 [An... 58 9e-07 ref|XP_020100694.1| plant cysteine oxidase 4-like isoform X1 [An... 58 2e-06 >ref|XP_009415235.1| PREDICTED: plant cysteine oxidase 4 [Musa acuminata subsp. malaccensis] Length = 242 Score = 70.9 bits (172), Expect = 5e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +1 Query: 1 LPSGVDASEVTWLEECQPPESFVVRRGPYKGQIVNN 108 LPSG+ AS+V WLEECQPPESF+VRRGPYKGQIVN+ Sbjct: 207 LPSGIKASDVIWLEECQPPESFIVRRGPYKGQIVNS 242 >ref|XP_009392425.1| PREDICTED: plant cysteine oxidase 4 [Musa acuminata subsp. malaccensis] ref|XP_018679447.1| PREDICTED: plant cysteine oxidase 4 [Musa acuminata subsp. malaccensis] ref|XP_018679448.1| PREDICTED: plant cysteine oxidase 4 [Musa acuminata subsp. malaccensis] Length = 244 Score = 64.7 bits (156), Expect = 8e-09 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +1 Query: 1 LPSGVDASEVTWLEECQPPESFVVRRGPYKGQIVN 105 LPS + +SEV WLEECQPPESF++RRGPY+GQIV+ Sbjct: 208 LPSAIRSSEVAWLEECQPPESFIIRRGPYRGQIVD 242 >ref|XP_020100708.1| plant cysteine oxidase 4-like isoform X3 [Ananas comosus] Length = 188 Score = 58.2 bits (139), Expect = 9e-07 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 1 LPSGVDASEVTWLEECQPPESFVVRRGPYKGQIVN 105 LPS ++AS+VTWLEE QPP+SFV+RRG YKG ++N Sbjct: 152 LPSEINASDVTWLEEYQPPDSFVIRRGLYKGPVIN 186 >ref|XP_020100694.1| plant cysteine oxidase 4-like isoform X1 [Ananas comosus] gb|OAY85142.1| Plant cysteine oxidase 4 [Ananas comosus] Length = 244 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 1 LPSGVDASEVTWLEECQPPESFVVRRGPYKGQIVN 105 LPS ++AS+VTWLEE QPP+SFV+RRG YKG ++N Sbjct: 208 LPSEINASDVTWLEEYQPPDSFVIRRGLYKGPVIN 242