BLASTX nr result
ID: Cheilocostus21_contig00021267
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00021267 (442 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIA54144.1| hypothetical protein AQUCO_00900599v1 [Aquilegia ... 76 7e-15 gb|PIA54136.1| hypothetical protein AQUCO_00900597v1 [Aquilegia ... 76 2e-14 ref|XP_016491484.1| PREDICTED: cytochrome c-type biogenesis CcmH... 72 5e-14 gb|PAN05000.1| hypothetical protein PAHAL_A01033 [Panicum hallii] 74 7e-14 ref|XP_022152937.1| cytochrome c-type biogenesis CcmH-like mitoc... 74 7e-14 ref|XP_021654902.1| cytochrome c-type biogenesis CcmH-like mitoc... 74 7e-14 ref|XP_021609408.1| cytochrome c-type biogenesis CcmH-like mitoc... 74 7e-14 ref|XP_017252638.1| PREDICTED: cytochrome c-type biogenesis CcmH... 74 7e-14 ref|XP_020272693.1| cytochrome c-type biogenesis CcmH-like mitoc... 72 9e-14 ref|XP_019707113.1| PREDICTED: cytochrome c-type biogenesis CcmH... 74 1e-13 ref|XP_010254055.1| PREDICTED: cytochrome c-type biogenesis CcmH... 74 1e-13 ref|XP_021646750.1| cytochrome c-type biogenesis CcmH-like mitoc... 74 1e-13 ref|XP_021901302.1| cytochrome c-type biogenesis CcmH-like mitoc... 74 1e-13 ref|XP_010062495.1| PREDICTED: cytochrome c-type biogenesis CcmH... 74 1e-13 ref|XP_017605108.1| PREDICTED: cytochrome c-type biogenesis CcmH... 73 1e-13 ref|XP_021901300.1| cytochrome c-type biogenesis CcmH-like mitoc... 74 2e-13 ref|XP_021298699.1| cytochrome c-type biogenesis CcmH-like mitoc... 73 2e-13 gb|OMO54072.1| Cytochrome C biogenesis protein CcmH [Corchorus c... 73 2e-13 ref|XP_007024200.2| PREDICTED: cytochrome c-type biogenesis CcmH... 73 2e-13 ref|XP_016688528.1| PREDICTED: cytochrome c-type biogenesis CcmH... 73 2e-13 >gb|PIA54144.1| hypothetical protein AQUCO_00900599v1 [Aquilegia coerulea] Length = 122 Score = 75.9 bits (185), Expect = 7e-15 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 +WAY K RQRTNVHIMALNLVRGVPLTPKEKQTMLE+LT Sbjct: 71 IWAYQKHRQRTNVHIMALNLVRGVPLTPKEKQTMLEILT 109 >gb|PIA54136.1| hypothetical protein AQUCO_00900597v1 [Aquilegia coerulea] gb|PIA54137.1| hypothetical protein AQUCO_00900597v1 [Aquilegia coerulea] gb|PIA54138.1| hypothetical protein AQUCO_00900597v1 [Aquilegia coerulea] gb|PIA54139.1| hypothetical protein AQUCO_00900597v1 [Aquilegia coerulea] gb|PIA54140.1| hypothetical protein AQUCO_00900597v1 [Aquilegia coerulea] Length = 153 Score = 75.9 bits (185), Expect = 2e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 +WAY K RQRTNVHIMALNLVRGVPLTPKEKQTMLE+LT Sbjct: 102 IWAYQKHRQRTNVHIMALNLVRGVPLTPKEKQTMLEILT 140 >ref|XP_016491484.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Nicotiana tabacum] Length = 76 Score = 72.4 bits (176), Expect = 5e-14 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 +WAY K RQ+TNVHIMALNLVRGVPLTPKEK+TMLE+LT Sbjct: 20 MWAYKKHRQKTNVHIMALNLVRGVPLTPKEKETMLEVLT 58 >gb|PAN05000.1| hypothetical protein PAHAL_A01033 [Panicum hallii] Length = 128 Score = 73.6 bits (179), Expect = 7e-14 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 +WAY K RQRTNVHIMALNLVRGVPLTP+EK+TMLE+LT Sbjct: 77 IWAYQKHRQRTNVHIMALNLVRGVPLTPREKETMLEILT 115 >ref|XP_022152937.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Momordica charantia] Length = 158 Score = 74.3 bits (181), Expect = 7e-14 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 VWAY K +Q+TNVHIMALNLVRGVPLTPKEKQTML+LLT Sbjct: 102 VWAYNKHKQKTNVHIMALNLVRGVPLTPKEKQTMLDLLT 140 >ref|XP_021654902.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Hevea brasiliensis] Length = 159 Score = 74.3 bits (181), Expect = 7e-14 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 +WAY K RQ+TNVHIMALNLVRGVPLTPKEK+TMLE+LT Sbjct: 102 IWAYNKHRQKTNVHIMALNLVRGVPLTPKEKETMLEILT 140 >ref|XP_021609408.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Manihot esculenta] ref|XP_021609409.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Manihot esculenta] gb|OAY53027.1| hypothetical protein MANES_04G130300 [Manihot esculenta] gb|OAY53028.1| hypothetical protein MANES_04G130300 [Manihot esculenta] Length = 159 Score = 74.3 bits (181), Expect = 7e-14 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 +WAY K RQ+TNVHIMALNLVRGVPLTPKEK+TMLE+LT Sbjct: 102 IWAYNKHRQKTNVHIMALNLVRGVPLTPKEKETMLEILT 140 >ref|XP_017252638.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Daucus carota subsp. sativus] gb|KZM92963.1| hypothetical protein DCAR_016208 [Daucus carota subsp. sativus] Length = 162 Score = 74.3 bits (181), Expect = 7e-14 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELL 329 +WAY K RQRTNVHIMALNL+RGVPLTPKEKQTMLE+L Sbjct: 102 IWAYNKHRQRTNVHIMALNLIRGVPLTPKEKQTMLEIL 139 >ref|XP_020272693.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Asparagus officinalis] Length = 98 Score = 72.4 bits (176), Expect = 9e-14 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 VWAY + RQ+TNVHIMALNLVRGVPLTPKEK+TML+LLT Sbjct: 48 VWAYQRHRQKTNVHIMALNLVRGVPLTPKEKETMLDLLT 86 >ref|XP_019707113.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Elaeis guineensis] Length = 150 Score = 73.6 bits (179), Expect = 1e-13 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 VWAY + RQ+TNVHIMALNLVRGVPLTPKEKQTML+LLT Sbjct: 101 VWAYQRHRQKTNVHIMALNLVRGVPLTPKEKQTMLDLLT 139 >ref|XP_010254055.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Nelumbo nucifera] Length = 150 Score = 73.6 bits (179), Expect = 1e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 +WAY K RQ+TNVHIMALNLVRGVPLTPKEKQTML++LT Sbjct: 102 IWAYQKHRQKTNVHIMALNLVRGVPLTPKEKQTMLDILT 140 >ref|XP_021646750.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Hevea brasiliensis] Length = 187 Score = 74.3 bits (181), Expect = 1e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 +WAY K RQ+TNVHIMALNLVRGVPLTPKEK+TMLE+LT Sbjct: 130 IWAYNKHRQKTNVHIMALNLVRGVPLTPKEKETMLEILT 168 >ref|XP_021901302.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein isoform X2 [Carica papaya] Length = 158 Score = 73.6 bits (179), Expect = 1e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 +WAY K RQ+TNVHIMALNLVRGVPLTPKEKQTML++LT Sbjct: 102 IWAYQKHRQKTNVHIMALNLVRGVPLTPKEKQTMLDILT 140 >ref|XP_010062495.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Eucalyptus grandis] gb|KCW69635.1| hypothetical protein EUGRSUZ_F03043 [Eucalyptus grandis] Length = 159 Score = 73.6 bits (179), Expect = 1e-13 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 VWAY K RQRTNVHIMALNLVRGVPLTP EK+TML+LLT Sbjct: 102 VWAYNKHRQRTNVHIMALNLVRGVPLTPNEKETMLDLLT 140 >ref|XP_017605108.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Gossypium arboreum] gb|KHG07223.1| Cytochrome c-type biogenesis CcmH [Gossypium arboreum] Length = 144 Score = 73.2 bits (178), Expect = 1e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 +WAY K RQ+TNVHIMALNLVRGVPLTPKEK+TML+LLT Sbjct: 102 MWAYNKHRQKTNVHIMALNLVRGVPLTPKEKETMLDLLT 140 >ref|XP_021901300.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein isoform X1 [Carica papaya] ref|XP_021901301.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein isoform X1 [Carica papaya] Length = 164 Score = 73.6 bits (179), Expect = 2e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 +WAY K RQ+TNVHIMALNLVRGVPLTPKEKQTML++LT Sbjct: 108 IWAYQKHRQKTNVHIMALNLVRGVPLTPKEKQTMLDILT 146 >ref|XP_021298699.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Herrania umbratica] ref|XP_021298700.1| cytochrome c-type biogenesis CcmH-like mitochondrial protein [Herrania umbratica] Length = 159 Score = 73.2 bits (178), Expect = 2e-13 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 +WAY K RQ TNVHIMALNLVRGVPLTPKEK+TML+LLT Sbjct: 102 IWAYNKHRQNTNVHIMALNLVRGVPLTPKEKETMLDLLT 140 >gb|OMO54072.1| Cytochrome C biogenesis protein CcmH [Corchorus capsularis] gb|OMO66673.1| Cytochrome C biogenesis protein CcmH [Corchorus olitorius] Length = 159 Score = 73.2 bits (178), Expect = 2e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 +WAY K RQ+TNVHIMALNLVRGVPLTPKEK+TML+LLT Sbjct: 102 IWAYKKHRQKTNVHIMALNLVRGVPLTPKEKETMLDLLT 140 >ref|XP_007024200.2| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Theobroma cacao] ref|XP_017978125.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Theobroma cacao] Length = 159 Score = 73.2 bits (178), Expect = 2e-13 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 +WAY K RQ TNVHIMALNLVRGVPLTPKEK+TML+LLT Sbjct: 102 IWAYNKHRQNTNVHIMALNLVRGVPLTPKEKETMLDLLT 140 >ref|XP_016688528.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Gossypium hirsutum] ref|XP_016688529.1| PREDICTED: cytochrome c-type biogenesis CcmH-like mitochondrial protein [Gossypium hirsutum] Length = 159 Score = 73.2 bits (178), Expect = 2e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 442 VWAYGKRRQRTNVHIMALNLVRGVPLTPKEKQTMLELLT 326 +WAY K RQ+TNVHIMALNLVRGVPLTPKEK+TML+LLT Sbjct: 102 MWAYNKHRQKTNVHIMALNLVRGVPLTPKEKETMLDLLT 140