BLASTX nr result
ID: Cheilocostus21_contig00021161
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00021161 (451 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009396278.1| PREDICTED: serine/Arginine-related protein 5... 55 5e-06 >ref|XP_009396278.1| PREDICTED: serine/Arginine-related protein 53 isoform X1 [Musa acuminata subsp. malaccensis] Length = 384 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = -3 Query: 437 SEALVSDKIIAMQQTSWRDRARRFRNDSES 348 +++LVSDK+IAMQQ+SWRDRARRFRNDS+S Sbjct: 355 TDSLVSDKVIAMQQSSWRDRARRFRNDSDS 384