BLASTX nr result
ID: Cheilocostus21_contig00021102
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00021102 (467 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009382537.1| PREDICTED: phytochrome A-associated F-box pr... 90 3e-18 ref|XP_018685357.1| PREDICTED: phytochrome A-associated F-box pr... 89 6e-18 gb|OEL15199.1| Phytochrome A-associated F-box protein [Dichanthe... 82 1e-17 ref|XP_008801107.1| PREDICTED: phytochrome A-associated F-box pr... 87 2e-17 ref|XP_010921679.1| PREDICTED: phytochrome A-associated F-box pr... 87 2e-17 gb|ONK62936.1| uncharacterized protein A4U43_C07F9660 [Asparagus... 84 2e-17 gb|PIA61388.1| hypothetical protein AQUCO_00300729v1 [Aquilegia ... 87 3e-17 gb|OVA00216.1| F-box domain [Macleaya cordata] 85 1e-16 ref|XP_017405719.1| PREDICTED: phytochrome A-associated F-box pr... 81 2e-16 gb|OMO81908.1| phytochrome A-associated F-box protein-like prote... 84 2e-16 ref|XP_014495243.1| phytochrome A-associated F-box protein [Vign... 84 3e-16 ref|XP_020272971.1| LOW QUALITY PROTEIN: phytochrome A-associate... 84 3e-16 ref|XP_015891879.1| PREDICTED: phytochrome A-associated F-box pr... 84 3e-16 ref|XP_010259577.1| PREDICTED: phytochrome A-associated F-box pr... 84 4e-16 ref|XP_021820093.1| phytochrome A-associated F-box protein [Prun... 84 4e-16 ref|XP_007201540.2| phytochrome A-associated F-box protein [Prun... 84 4e-16 ref|XP_008235229.1| PREDICTED: phytochrome A-associated F-box pr... 84 4e-16 ref|XP_008345211.1| PREDICTED: phytochrome A-associated F-box pr... 84 5e-16 ref|XP_008369011.1| PREDICTED: phytochrome A-associated F-box pr... 84 5e-16 ref|XP_008386700.1| PREDICTED: phytochrome A-associated F-box pr... 84 5e-16 >ref|XP_009382537.1| PREDICTED: phytochrome A-associated F-box protein [Musa acuminata subsp. malaccensis] Length = 343 Score = 89.7 bits (221), Expect = 3e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLYA 351 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLYA Sbjct: 305 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLYA 343 >ref|XP_018685357.1| PREDICTED: phytochrome A-associated F-box protein-like [Musa acuminata subsp. malaccensis] Length = 337 Score = 88.6 bits (218), Expect = 6e-18 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLYA 351 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLY+ Sbjct: 299 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLYS 337 >gb|OEL15199.1| Phytochrome A-associated F-box protein [Dichanthelium oligosanthes] Length = 83 Score = 82.0 bits (201), Expect = 1e-17 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLYA 351 AFCLR +GFHDDGEPVVRAYVCENGHV+GAWTERPLY+ Sbjct: 45 AFCLRSFYGFHDDGEPVVRAYVCENGHVAGAWTERPLYS 83 >ref|XP_008801107.1| PREDICTED: phytochrome A-associated F-box protein [Phoenix dactylifera] Length = 333 Score = 87.4 bits (215), Expect = 2e-17 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLY 354 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERP+Y Sbjct: 295 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPMY 332 >ref|XP_010921679.1| PREDICTED: phytochrome A-associated F-box protein [Elaeis guineensis] Length = 344 Score = 87.4 bits (215), Expect = 2e-17 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLY 354 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERP+Y Sbjct: 303 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPIY 340 >gb|ONK62936.1| uncharacterized protein A4U43_C07F9660 [Asparagus officinalis] Length = 176 Score = 84.0 bits (206), Expect = 2e-17 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLY 354 AFCLRRVFG+HDDGEPVVRAYVCENGHVSGAWT++P+Y Sbjct: 138 AFCLRRVFGYHDDGEPVVRAYVCENGHVSGAWTDKPMY 175 >gb|PIA61388.1| hypothetical protein AQUCO_00300729v1 [Aquilegia coerulea] Length = 325 Score = 86.7 bits (213), Expect = 3e-17 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLYA 351 AFCLRRVFG+HDDGEPVVRAYVCENGHVSGAWTERP+Y+ Sbjct: 287 AFCLRRVFGYHDDGEPVVRAYVCENGHVSGAWTERPMYS 325 >gb|OVA00216.1| F-box domain [Macleaya cordata] Length = 340 Score = 85.1 bits (209), Expect = 1e-16 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLY 354 AFCLRRVFG+HDDGEPVVRAYVCENGHVSGAWT+RP+Y Sbjct: 302 AFCLRRVFGYHDDGEPVVRAYVCENGHVSGAWTDRPMY 339 >ref|XP_017405719.1| PREDICTED: phytochrome A-associated F-box protein-like [Vigna angularis] gb|KOM25637.1| hypothetical protein LR48_Vigan148s000100 [Vigna angularis] Length = 162 Score = 81.3 bits (199), Expect = 2e-16 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLY 354 AFCL RVFGFHDDGEPVVRAYVCENGHVSGAWT+ P+Y Sbjct: 124 AFCLHRVFGFHDDGEPVVRAYVCENGHVSGAWTDVPMY 161 >gb|OMO81908.1| phytochrome A-associated F-box protein-like protein [Corchorus olitorius] Length = 321 Score = 84.3 bits (207), Expect = 2e-16 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLY 354 AFCLRRVFG+HDDGEPVVRAYVCENGHVSGAWTE PLY Sbjct: 283 AFCLRRVFGYHDDGEPVVRAYVCENGHVSGAWTELPLY 320 >ref|XP_014495243.1| phytochrome A-associated F-box protein [Vigna radiata var. radiata] Length = 312 Score = 84.0 bits (206), Expect = 3e-16 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLY 354 AFCLRRV+GFHDDGEPVVRAYVCENGHVSGAWT++P+Y Sbjct: 274 AFCLRRVYGFHDDGEPVVRAYVCENGHVSGAWTDKPMY 311 >ref|XP_020272971.1| LOW QUALITY PROTEIN: phytochrome A-associated F-box protein [Asparagus officinalis] Length = 316 Score = 84.0 bits (206), Expect = 3e-16 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLY 354 AFCLRRVFG+HDDGEPVVRAYVCENGHVSGAWT++P+Y Sbjct: 278 AFCLRRVFGYHDDGEPVVRAYVCENGHVSGAWTDKPMY 315 >ref|XP_015891879.1| PREDICTED: phytochrome A-associated F-box protein [Ziziphus jujuba] Length = 336 Score = 84.0 bits (206), Expect = 3e-16 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLY 354 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWT+ PLY Sbjct: 298 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTDWPLY 335 >ref|XP_010259577.1| PREDICTED: phytochrome A-associated F-box protein isoform X2 [Nelumbo nucifera] Length = 318 Score = 83.6 bits (205), Expect = 4e-16 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLY 354 AFCLRRVFG+HDDGEPVVRAYVCENGHVSGAWT+RP++ Sbjct: 280 AFCLRRVFGYHDDGEPVVRAYVCENGHVSGAWTDRPMF 317 >ref|XP_021820093.1| phytochrome A-associated F-box protein [Prunus avium] Length = 325 Score = 83.6 bits (205), Expect = 4e-16 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLYA 351 AFCLRRVFG+HDDGEPVVRAYVCENGHVSGAWT+ PLY+ Sbjct: 287 AFCLRRVFGYHDDGEPVVRAYVCENGHVSGAWTDLPLYS 325 >ref|XP_007201540.2| phytochrome A-associated F-box protein [Prunus persica] gb|ONH93919.1| hypothetical protein PRUPE_8G260500 [Prunus persica] Length = 325 Score = 83.6 bits (205), Expect = 4e-16 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLYA 351 AFCLRRVFG+HDDGEPVVRAYVCENGHVSGAWT+ PLY+ Sbjct: 287 AFCLRRVFGYHDDGEPVVRAYVCENGHVSGAWTDLPLYS 325 >ref|XP_008235229.1| PREDICTED: phytochrome A-associated F-box protein [Prunus mume] Length = 325 Score = 83.6 bits (205), Expect = 4e-16 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLYA 351 AFCLRRVFG+HDDGEPVVRAYVCENGHVSGAWT+ PLY+ Sbjct: 287 AFCLRRVFGYHDDGEPVVRAYVCENGHVSGAWTDLPLYS 325 >ref|XP_008345211.1| PREDICTED: phytochrome A-associated F-box protein-like [Malus domestica] Length = 340 Score = 83.6 bits (205), Expect = 5e-16 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLYA 351 AFCLRRVFG+HDDGEPVVRAYVCENGHVSGAWT+ PLY+ Sbjct: 302 AFCLRRVFGYHDDGEPVVRAYVCENGHVSGAWTDLPLYS 340 >ref|XP_008369011.1| PREDICTED: phytochrome A-associated F-box protein-like [Malus domestica] Length = 340 Score = 83.6 bits (205), Expect = 5e-16 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLYA 351 AFCLRRVFG+HDDGEPVVRAYVCENGHVSGAWT+ PLY+ Sbjct: 302 AFCLRRVFGYHDDGEPVVRAYVCENGHVSGAWTDLPLYS 340 >ref|XP_008386700.1| PREDICTED: phytochrome A-associated F-box protein [Malus domestica] Length = 345 Score = 83.6 bits (205), Expect = 5e-16 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 467 AFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTERPLYA 351 AFCLRRVFG+HDDGEPVVRAYVCENGHVSGAWT+ PLY+ Sbjct: 307 AFCLRRVFGYHDDGEPVVRAYVCENGHVSGAWTDLPLYS 345